Alcohol dehydrogenase from Thermococcus kodakarensis KOD1

Enzyme Description

Species
Thermococcus kodakarensis KOD1 β†—
Extremophile
Yes "hyperthermophilic" organism
EC Number
1.1.1.1 β†—

Sequence

Length: 278 amino acids
MKKVRIFNDLKWIGDDKVTAIGMGTWGIGGYESPDYSKDNESVEVLRHGLELGINLIDTAEFYGAGHSEELVGEAIKEFERDDIFIISKVWPTHFGYEEAKRAARASAKRLGTYIDLYLLHWPGDSWEKIKETLHALEELVDEGLIRYIGVSNFDLELLKRSQEAMKKYEIVANEVKYSLKDRWPETTGLLDYMKREGIALIAYTPLEKGTLARNECLAEIGKKYGKTAAQVALNYLIWEENVIAIPKAGNKAHLEENFGAMGWRLSKEDRENARGCV
Xi Wu et al. (2013) β€” Thermostable Alcohol Dehydrogenase from Thermococcus kodakarensis KOD1 for Enantioselective Bioconversion of Aromatic Secondary Alcohols
Applied and Environmental Microbiology  Β· doi:10.1128/AEM.03873-12 β†—  Β· Activity - Classical Stability - Incubation
20 measurements ▼
Database ID
UniProt: Q5JI09 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 100.0 24.2 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Methanol 20% 100.0 44.4 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Ethanol 20% 100.0 54.2 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Acetone 20% 100.0 14.7 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Isopropanol 20% 100.0 92.6 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Ethyl Acetate 50% 100.0 10.4 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent 1-Octanol 50% 100.0 47.7 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent n-Hexane 50% 100.0 113.8 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent n-Octane 50% 100.0 99.7 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurment, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100.0 27.2 % 50 mM glycine-NaOH 9 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Classical aqueous control (in %)
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase n-Octane 50% 100.0 94.6 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase n-Hexane 50% 100.0 96.9 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase 1-Octanol 50% 100.0 84.7 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Ethyl Acetate 50% 100.0 88.8 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Isopropanol 20% 100.0 110.1 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Acetone 20% 100.0 93.9 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Ethanol 20% 100.0 101.0 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Methanol 20% 100.0 98.4 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Dimethylformamide (DMF) 20% 100.0 96.6 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 60Β°C), measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20% 100.0 102.0 % Incubation: 50 mM glycine-NaOH, Assay: 50 mM glycine-NaOH Incubation: 9, Assay: 9 Incubation: 60Β°C, Assay: 70Β°C 100 mM (RS)-1-Phenylethanol (R)-1-Phenylethanol , (S)-1-Phenylethanol 1 mM NAD(P)+ β€” Non-incubated control (in %), activity measured in aqueous phase

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*