Short-chain NAD(H)-dependent dehydrogenase/reductase Sulfolobus acidocaldarius DSM 639

Enzyme Description

Extremophile
Yes "thermoacidophilic" organism
EC Number

Sequence

Length: 255 amino acids
MSYQSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAVVVDGGLTVL
Angela Pennacchio et al. (2012) β€” Biochemical and structural characterization of recombinant short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius highly enantioselective on diaryl diketone benzil
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-012-4273-z β†—  Β· Stability - Incubation
8 measurements
Database ID
UniProt: Q4J9F2 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (8 measurements)

8 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) Dimethyl Sulfoxide (DMSO) 18% 122 142 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) Dimethyl Sulfoxide (DMSO) 18% 107 105 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) Acetonitrile 18% 122 84 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) Acetonitrile 18% 107 72 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) 1,4-Dioxane 18% 122 135 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) 1,4-Dioxane 18% 107 97 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) Ethyl Acetate 18% 122 95 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) Ethyl Acetate 18% 107 96 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 50Β°C, Assay: 50Β°C 18 mM Cycloheptanol Cycloheptanone 3 mM NAD+ β€” Water-incubated control (in %) | 100% is the initial activity measured with the organic solvent, and 122/107 the change in activity after incubating in aqueous phase for the same duration

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*