Lipase (gene Lpc53E1) from a marine sponge Haliclona simulans metagenomic library

Enzyme Description

Species
Na (marine sponge Haliclona simulans metagenomic library)
Extremophile
No but "halo-tolerant" enzyme
EC Number
3.1.1.3 β†—

Sequence

Length: 387 amino acids
MKSRLNDILEAGIASGAAPGAVAIVVNADGVLWEGAAGERAVGTGRSMTTDTVGAIFSMTKAITGAAAMQLVEQNRLDLDAPAGEIIPWLNEVQVLDGFDDSGEPVLRAPNSPVTLRNLLTHTSGFTYEFWNANEARWKEKTGALSLFTLENAALQTPLAFDPGTQWEYGIGIDWVGKMVEAVSGMTLGEYFAEYLTGPLGMTDTAFTHSASMLERASAVHARLPDGTFQTIDLPQPENQEFEMGGGGLQGTMHDYGKFIRMILNDGELNGVRVLRSETVATMCENHIGDLRVQKLVTVAPTITNDAEFFPGRPKSWGLTFQINERAEDTGRPAGTLMWAGVLNSFFWIDRTNGVGGAYLSQMLPFADARSLGLFYDIERAVYQSLA
Joseph Selvin et al. (2012) β€” Isolation identification and biochemical characterization of a novel halo-tolerant lipase from the metagenome of the marine sponge Haliclona simulans
Microbial Cell Factories  Β· doi:10.1186/1475-2859-11-72 β†—  Β· Stability - Incubation
18 measurements ▼
Database ID
UniParc: UPI000266165D β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli DH5alpha

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 20% 100.0 220.5 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 20% 100.0 271.2 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 20% 100.0 214.3 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20% 100.0 220.5 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 20% 100.0 208.2 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 20% 100.0 473.4 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 20% 100.0 176.4 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 20% 100.0 195.4 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 20% 100.0 157.4 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100.0 126.1 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 10% 100.0 155.1 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 10% 100.0 270.3 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100.0 126.1 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100.0 119.0 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 10% 100.0 122.3 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100.0 101.0 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 10% 100.0 111.4 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 10% 100.0 90.1 % Incubation: ?, Assay: 50 mM Tris- HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 4% (v/v) isopropanol, 1% (v/v) acetonitrile Incubation: ?, Assay: 8.2 Incubation: 4Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Unclear control (in %), activity measured in aqueous phase | High uncertainty about whether the assay was measured with or without organic solvent, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*