Elastase from Pseudomonas aeruginosa ME-4
Enzyme Description
Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNGSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
Shinji Takenaka et al. (2012)
β Organic solvent-tolerant elastase efficiently hydrolyzes insoluble, cross-linked, protein fiber of eggshell membranes
Biotechnology Letters
Β· doi:10.1007/s10529-012-0861-3 β
Β· Activity - Classical
▼
Database ID
UniProt: L8AX98 β
Sequence Annotation
Explicit - Provided (197 first residues from UniProt cleaved from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Acetone | Β±100% | 100.0 | 54.0 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Dimethyl Sulfoxide (DMSO) | Β±100% | 100.0 | 35.0 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Isopropanol | Β±100% | 100.0 | 75.0 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Ethanol | Β±100% | 100.0 | 79.0 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Benzene | Β±100% | 100.0 | 1.7 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Cyclohexane | Β±100% | 100.0 | 0.0 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (amount of soluble peptides in post-centrifugation supernatant measurement) | Toluene | Β±100% | 100.0 | 0.0 | % | 10 mM phosphate buffer | 6.5 | 50Β°C | 150 mg (solid) Eggshell membrane (solid) | Soluble peptides | β | 140 rpm | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.