Deoxyribose-phosphate aldolase from Escherichia coli

Enzyme Description

Species

Extremophile

EC Number

4.1.2.4 ↗

Sequence

Length: 259 amino acids

MTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY

Irene Kullartz et al. (2012) — Cloning and characterisation of a new 2-deoxy-d-ribose-5-phosphate aldolase from Rhodococcus erythropolis

Journal of Biotechnology · doi:10.1016/j.jbiotec.2011.12.018 ↗ · Activity - Classical

8 measurements ▼

Database ID

UniProt: P0A6L0 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (8 measurements)

8 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	20%	100	0	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Methanol	20%	100	39	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Acetonitrile	20%	100	4	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	84	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	20%	100	66	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Isopropanol	20%	100	13	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Ethyl Acetate	20%	100	46	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Ethanol	20%	100	43	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde , Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	20%	100	0	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Methanol	20%	100	39	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Acetonitrile	20%	100	4	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	84	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	20%	100	66	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Isopropanol	20%	100	13	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Ethyl Acetate	20%	100	46	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADH absorbance measurement, from glycerol-3-phosphate dehydrogenase-catalyzed reaction usign dihydroxyacetone phosphate as substrate, itself obtained the product of the triose-phosphate isomerase-catalyzed reaction with glyceraldehyde 3-phosphate, 340 nm) in the presence of organic solvent	Ethanol	20%	100	43	%	100 mM potassium phosphate buffer, 4 U GDH, 11 U TPI, 0.1 mM NADH	7	25°C	0.4 mM 2-Deoxy-D-ribose 5-phosphate	Acetaldehyde, Glyceraldehyde 3-phosphate	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*