Lipase CaLIP10 from Candida albicans

Enzyme Description

Species

Extremophile

EC Number

3.1.1.3 ↗

Sequence

Length: 465 amino acids

MKTLLIFLAFLSSIFASLIGLTPPSKDSFYSPPVGFATAKPGDILKIRNTPSAPSSLYLPIVVKNAWQLLIRSEDSFGNPNAFVATLIQPLNANPSKLVSYQSWEDASHIDCSPSYGMQFKSPATTVTTQIDMTLIVPLLQNGYYVIIPDYEGPKSTFTVGRQSGKATLNSIRAALQTGAFSGIKKTAKVALWGYSGGSLATGWAISLQSKYAPELKENLIGAAVGGFATNITAVAEAVDGTVFSGFIPLALNGLANEYPDFKKRLYGEVKLSARSTMEKGSQNCLAASLVGYPMSQYFTGQNRAFEKGWGLLQDEVFNKTIEDNLLLKLDKTYLPQVPVLIYHGTIDEIIPIKDANAQYQIWCDRGIQSLEFAEDLSAGHLAETFTGAPAALSWIDARFSGKPAVNGCQRTIRSSNVLYPGISITIRIYFEGISKTIFGVNLGSGVNADKSISNKFFAYIRKYI

Dongming Lan et al. (2011) — Optimal Production and Biochemical Properties of a Lipase from Candida albicans

International Journal of Molecular Sciences · doi:10.3390/ijms12107216 ↗ · Stability - Incubation

4 measurements ▼

Database ID

UniProt: Q9P4E5 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host yeast Pichia pastoris X33

Experimental Data (4 measurements)

4 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	30%	100.0	56.44	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	30%	100.0	73.39	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	30%	100.0	59.04	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	30%	100.0	44.14	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent

Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	30%	100.0	56.44	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	30%	100.0	73.39	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	30%	100.0	59.04	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	30%	100.0	44.14	%	Incubation: 50 mM Tris-HC, Assay: 50 mM Tris-HCl	Incubation: 8, Assay: 8	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), control and residual activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*