Class II fructose-bisphosphate aldolase from Pseudomonas aeruginosa PAO1

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 354 amino acids
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAPFLRHLILAAIEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLREDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAEGVLDHSQLLTDPEEAADFVKKTKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHARIPDTHLVMHGSSSVPQDWLAIINEYGGEIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAIRRFLAQNPSEFDPRKYFSKTVEAMRDICIARYEAFGTAGNASKIKPISLEGMFQRYARGELDPKVN
Geneviève Labbé et al. (2011) — Evaluation of four microbial Class II fructose 1,6-bisphosphate aldolase enzymes for use as biocatalysts
Protein Expression and Purification  Β· doi:10.1016/j.pep.2011.06.020 β†—  Β· Stability - C50
5 measurements
Database ID
UniProt: Q9I5Y1 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (5 measurements)

5 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - C50 Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±βˆ’ glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) β€” β€” 50 % (v/v) Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C ? mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±βˆ’ glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase Dimethylformamide (DMF) β€” β€” 35 % (v/v) Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C ? mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±βˆ’ glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase Acetone β€” β€” 25 % (v/v) Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C ? mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±βˆ’ glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase tert-Butanol β€” β€” 15 % (v/v) Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C ? mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±βˆ’ glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase Acetonitrile β€” β€” 15 % (v/v) Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C ? mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate β€” β€” Not applicable control (in % (v/v))

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*