Class II fructose-bisphosphate aldolase from Bacillus cereus ATCC 10987
Enzyme Description
Sequence
MPLVSMKEMLNKALEGKYAVGQFNMNNLEWTQAILAAAEEEKSPVILGVSEGAARHMTGFKTVVAMVKALIEEMNITVPVAIHLDHGSSFEKCKEAIDAGFTSVMIDASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIAEGVIYADPAECKHLVEATGIDCLAPALGSVHGPYKGEPNLGFAEMEQVRDFTGVPLVLHGGTGIPTADIEKAISLGTSKINVNTENQIEFTKAVREVLNKDQEVYDPRKFIGPGRDAIKATVIGKIREFGSNGKA
Geneviève Labbé et al. (2011)
β Evaluation of four microbial Class II fructose 1,6-bisphosphate aldolase enzymes for use as biocatalysts
Protein Expression and Purification
Β· doi:10.1016/j.pep.2011.06.020 β
Β· Stability - C50
▼
Database ID
UniProt: Q72XB3 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (5 measurements)
5 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - C50 | Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±β glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | β | β | >50 | % (v/v) | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | ? mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate | β | β | Not applicable control (in % (v/v)) |
| Stability - C50 | Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±β glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase | Dimethylformamide (DMF) | β | β | 50 | % (v/v) | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | ? mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate | β | β | Not applicable control (in % (v/v)) |
| Stability - C50 | Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±β glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase | Acetone | β | β | 25 | % (v/v) | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | ? mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate | β | β | Not applicable control (in % (v/v)) |
| Stability - C50 | Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±β glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase | tert-Butanol | β | β | 5 | % (v/v) | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | ? mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate | β | β | Not applicable control (in % (v/v)) |
| Stability - C50 | Volume fraction of organic solvent for which more than 50% of activity is retained after incubation (3.5 hours at room temperature), measured by absorbance spectrophotometry (NADH absorbance measurement, as the enzyme Ξ±β glycerophosphate dehydrogenase transforms reaction product dihydroxyacetone phosphate into Ξ± -glycerophosphateusing NADH, 340 nm) in aqueous phase | Acetonitrile | β | β | 10 | % (v/v) | Incubation: 50 mM Tris-HCl, Assay: 50 mM Tris-HCl, 100 mM potassium acetate, 0.2 mg/mL BSA, 0.2 U/mL of rab- bit muscle a-glycerophosphate dehydrogenase, 2.25 U/mL of rab- bit muscle triose phosphate isomerase, 0.3 MM NADH | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | ? mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde 3-phosphate | β | β | Not applicable control (in % (v/v)) |
Visualization : Stability β C50
One bar per measurement. Colour = solvent, shade = temperature. Hover for details.