Lipase (gene lip5) from Candida albicans

Enzyme Description

Species

Candida albicans ↗

Extremophile

No but "cold-active" enzyme

EC Number

3.1.1.3 ↗

Sequence

Length: 463 amino acids

MLYLILFLIAPIYAGLIFPTKPSSDPFYNPPKGFENAAVGDILQSRATPKSITGGFTPLKIQNSWQLLVRSEDSFGNPNVIVTTVIEPVNADPSKIASYQVFEDAAKADCAPSYALQFGSDLTTFVTQAEMYLMAPLLDQGYYVVSPDYEGPKSTFTIGKQSGQAVLNSIRAALKSGKITNIKDDAKVVMWGYSGGSLASGWAAALQPSYAPELGGNLLGAALGGFVTNITATAQATDGTVFAGIVANALGGVANEYPEFKSILQSDTDKKSVFDEFDGHCLIDGVLNYIGTSFLTGDHKIFKTGWDILKNPKIGKVVEDNGLVYQKQLVPKIPVFIYHGSIDQIVPIVDTKKTYQNWCDAGISSLEFAEDASNGHLTEAIMGAPAALTWIIDRFDGKQTVSGCQHIQRFSNLEYPNIPSSIANYFKAAMDVVLHLGLGPDVQKDQVSPEGIKKLGSIEMRWL

Dong-Ming Lan et al. (2011) — A Novel Cold-Active Lipase from Candida albicans: Cloning, Expression and Characterization of the Recombinant Enzyme

International Journal of Molecular Sciences · doi:10.3390/ijms12063950 ↗ · Stability - Incubation

4 measurements ▼

Database ID

UniProt: Q9P8W0 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host yeast Pichia pastoris X33

Experimental Data (4 measurements)

4 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	30%	100.0	48.23	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	30%	100.0	24.32	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	30%	100.0	44.76	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	30%	100.0	4.59	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent

Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	30%	100.0	48.23	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	30%	100.0	24.32	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	30%	100.0	44.76	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	30%	100.0	4.59	%	Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer	Incubation: 6, Assay: 6	Incubation: 4°C, Assay: 25°C	2 mM p-Nitrophenyl caprylate	Caprylic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay done with or without organic solvent

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*