R-selective hydroxynitrile lyase from Arabidopsis thaliana

Enzyme Description

Species

Extremophile

EC Number

4.1.2.10 ↗ (Henry reaction)

Sequence

Length: 258 amino acids

MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM

Ken-ichi Fuhshuku et al. (2011) — Synthesis of (R)-β-nitro alcohols catalyzed by R-selective hydroxynitrile lyase from Arabidopsis thaliana in the aqueous–organic biphasic system

Journal of Biotechnology · doi:10.1016/j.jbiotec.2011.03.011 ↗ · Activity + Stability - Product Formation Specificity - Enantioselectivity

18 measurements ▼

Database ID

UniProt: Q9LFT6 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (18 measurements)

18 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	50%	68.25	66.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	tert-Butyl Methyl Ether (MTBE)	50%	68.25	26.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Ethyl Acetate	50%	68.25	7.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Butyl Acetate	50%	68.25	52.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	n-Hexane	50%	68.25	1.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Cyclohexane	50%	68.25	2.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Toluene	50%	68.25	23.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Xylene	50%	68.25	26.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diethyl Ether	50%	68.25	35.5	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Xylene	50%	24.0	81.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Toluene	50%	24.0	83.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Cyclohexane	50%	24.0	42.5	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	n-Hexane	50%	24.0	27.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Butyl Acetate	50%	24.0	95.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Ethyl Acetate	50%	24.0	49.5	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	tert-Butyl Methyl Ether (MTBE)	50%	24.0	61.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	50%	24.0	85.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diethyl Ether	50%	24.0	34.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)

Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	50%	68.25	66.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	tert-Butyl Methyl Ether (MTBE)	50%	68.25	26.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Ethyl Acetate	50%	68.25	7.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Butyl Acetate	50%	68.25	52.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	n-Hexane	50%	68.25	1.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Cyclohexane	50%	68.25	2.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Toluene	50%	68.25	23.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Xylene	50%	68.25	26.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product yield after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diethyl Ether	50%	68.25	35.5	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Xylene	50%	24.0	81.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Toluene	50%	24.0	83.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Cyclohexane	50%	24.0	42.5	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	n-Hexane	50%	24.0	27.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Butyl Acetate	50%	24.0	95.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Ethyl Acetate	50%	24.0	49.5	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	tert-Butyl Methyl Ether (MTBE)	50%	24.0	61.25	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	50%	24.0	85.75	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward the R form) after incubation (2 hours at 30°C) in the presence of organic solvent, measured by HPLC	Diethyl Ether	50%	24.0	34.0	%	20 mM potassium phosphate buffer	7	30°C	25 µM Benzaldehyde, 50 µL Nitromethane	(R)-2-Nitro-1-phenylethanol	—	1200 rpm	Classical aqueous control (in %)

Visualization : Activity + Stability — Product Formation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity — Enantioselectivity