Lipase from Acinetobacter sp. XMZ-26

Enzyme Description

Extremophile
No but"cold-adapted" enzyme
EC Number

Sequence

Length: 317 amino acids
MTQQSSMHYRLSEEMQSLVYWSSIYSPADDDIDSIRAAYDAMCLHYTLPRDGTVNIEDKTVPQLNHPVNVRLYSPLGEAPATGWPCILYLHGGGWMVGNLDSHEFITRYLCRDLNVAVLSVDYRLTPEHHFPAAYEDCETVYHWLYQHGLQWKINPNQIVLMGDSAGGNLAAALAVQLQHTGAQACGLAMIYPCLSSGFDTASCQQQADAPLLSLADMHDYLQAYAPNTSDWQDLRLSPLLAQDFSDMPRSFIAVAEYDPLSDDGRIFADKLKQANIATEFYLGKGLLHGSLRLVRDCPVVQDLYQRMLSSLKPMFN
Xiaomei Zheng et al. (2011) β€” A novel cold-adapted lipase from Acinetobacter sp. XMZ-26: gene cloning and characterisation
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-011-3154-1 β†—  Β· Activity - Classical
14 measurements
Database ID
UniProt: D7NN82 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100.0 141.13 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15% 100.0 89.31 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15% 100.0 51.33 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Propanediol 15% 100.0 129.52 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Glycerol 15% 100.0 103.65 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG-600 15% 100.0 146.04 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 126.1 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 121.46 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 66.16 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 23.64 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Propanediol 30% 100.0 138.52 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Glycerol 30% 100.0 109.64 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent PEG-600 30% 100.0 176.77 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 125.29 % 50 mM Tris-HCl buffer, 1% Ethanol 9 20Β°C 500 Β΅M p-Nitrophenyl decanoate Decanoic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*