Lipase from Acinetobacter sp. XMZ-26
Enzyme Description
Extremophile
No
but"cold-adapted" enzyme
EC Number
Sequence
MTQQSSMHYRLSEEMQSLVYWSSIYSPADDDIDSIRAAYDAMCLHYTLPRDGTVNIEDKTVPQLNHPVNVRLYSPLGEAPATGWPCILYLHGGGWMVGNLDSHEFITRYLCRDLNVAVLSVDYRLTPEHHFPAAYEDCETVYHWLYQHGLQWKINPNQIVLMGDSAGGNLAAALAVQLQHTGAQACGLAMIYPCLSSGFDTASCQQQADAPLLSLADMHDYLQAYAPNTSDWQDLRLSPLLAQDFSDMPRSFIAVAEYDPLSDDGRIFADKLKQANIATEFYLGKGLLHGSLRLVRDCPVVQDLYQRMLSSLKPMFN
Xiaomei Zheng et al. (2011)
β A novel cold-adapted lipase from Acinetobacter sp. XMZ-26: gene cloning and characterisation
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-011-3154-1 β
Β· Activity - Classical
▼
Database ID
UniProt: D7NN82 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15% | 100.0 | 141.13 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 15% | 100.0 | 89.31 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 15% | 100.0 | 51.33 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Propanediol | 15% | 100.0 | 129.52 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Glycerol | 15% | 100.0 | 103.65 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG-600 | 15% | 100.0 | 146.04 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 126.1 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 121.46 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 66.16 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30% | 100.0 | 23.64 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Propanediol | 30% | 100.0 | 138.52 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Glycerol | 30% | 100.0 | 109.64 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | PEG-600 | 30% | 100.0 | 176.77 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 125.29 | % | 50 mM Tris-HCl buffer, 1% Ethanol | 9 | 20Β°C | 500 Β΅M p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.