Esterase from Geobacillus sp. GSM-2009a

Enzyme Description

Species

Geobacillus sp. GSM-2009a ↗

Extremophile

Yes thermophilic organism

EC Number

3.1.1.1 ↗

Sequence

Length: 247 amino acids

MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKTLKALQELIADVRAHLDLVYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW

Hasan Cihad Tekedar et al. (2010) — Molecular cloning, over expression and characterization of thermoalkalophilic esterases isolated from Geobacillus sp.

Extremophiles · doi:10.1007/s00792-010-0344-1 ↗ · Activity - Classical

6 measurements ▼

Database ID

UniProt: E4WLM1 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (6 measurements)

6 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Isopropanol	1%	100	41	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Ethanol	1%	100	89	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Methanol	1%	100	97	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Acetone	1%	100	88	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	n-Hexane	1%	100	67	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Chloroform	1%	100	25	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Isopropanol	1%	100	41	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Ethanol	1%	100	89	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Methanol	1%	100	97	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Acetone	1%	100	88	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	n-Hexane	1%	100	67	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent	Chloroform	1%	100	25	%	100 mM sodium phosphate buffer with 150 mM sodium chloride and 0.5% (v/v) Triton X-100	7.2	55°C	0.5 mM p-Nitrophenyl acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*