Elastase from Pseudomonas aeruginosa K

Enzyme Description

Species
Pseudomonas aeruginosa K β†—
Extremophile
No
EC Number
3.4.24.26 β†—

Sequence

Length: 301 amino acids
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNGSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
Chee Fah Wong et al. (2010) β€” Organic-solvent stability of elastase strain K overexpressed in an Escherichia–Pseudomonas expression system
Biotechnology and Applied Biochemistry  Β· doi:10.1042/BA20100224 β†—  Β· Activity + Stability - Incubation
14 measurements ▼
Database ID
UniProt: A7LI11 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli and Pseudomonas aeruginosa

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25% 100 107 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent Methanol 25% 100 73 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent Ethanol 25% 100 98 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent Isopropanol 25% 100 90 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent 1-Butanol 25% 100 58 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent Benzene 25% 100 43 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent Toluene 25% 100 82 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent p-Xylene 25% 100 15 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent n-Hexane 25% 100 60 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent 1-Decanol 25% 100 99 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent n-Decane 25% 100 22 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent n-Dodecane 25% 100 121 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent n-Tetradecane 25% 100 26 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C), measured by absorbance spectrophotometry (soluble dye-labelled peptides absorbance measurement, 495 nm) in the presence of organic solvent n-Hexadecane 25% 100 28 % Incubation: Crude purified enzyme, Assay: crude purified enzyme ? Incubation: 37Β°C, Assay: 37Β°C 10 mg / 3 mL Elastin–Congo red Soluble dye-labeled peptides β€” Incubation: 200 rpm Water-incubated control (in %)

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*