Aldo-keto reductase from Thermotoga maritima

Enzyme Description

Species

Thermotoga maritima ↗

Extremophile

Yes "thermophilic" organism

EC Number

1.1.1.2 ↗

Sequence

Length: 333 amino acids

MGIPKRKLGERGPEVSAIGLGCMRMSFGQKKLPDRKEMIKLIRTAVELGINFFDTAEVYGPYTNEELVGEALEPFKGEVVIATKFGFELYEDGRPGWKGLNSNPEHIKKAVEGSLRRLRVEAIDILYQHRVDPNVPIEEVAGAVKELIEEGKVKHFGLCEASAETIRRAHKVCPVDVVQYEYSMWWRKPEEELLPTCEELGIGFVAYSPLGKGFLTGAIGENSKFDEEDSRSRIPRFQKENLRENLALVELRKTIAERKGATPSQIALAWLLAQKPWIVPIPGTTKLSHLLENIGGAFVELTPEELQEINDALSRIEIKGSRYPEDMEKMTYL

Simon Willies et al. (2010) — Thermophilic enzymes and their applications in biocatalysis: a robust aldo-keto reductase

Environmental Technology · doi:10.1080/09593330.2010.490857 ↗ · Stability - Incubation

14 measurements ▼

Database ID

UniProt: Q9X0A1 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21

Experimental Data (14 measurements)

14 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	5%	100	84	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	20%	100	64	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	40%	100	8	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	60%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	5%	100	84	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	20%	100	28	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	40%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	1-Butanol	5%	100	66	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	1-Butanol	20%	100	30	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	1-Butanol	40%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	78	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	71	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100	29	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	60%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent

Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	5%	100	84	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	20%	100	64	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	40%	100	8	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	60%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	5%	100	84	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	20%	100	28	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	40%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	1-Butanol	5%	100	66	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	1-Butanol	20%	100	30	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	1-Butanol	40%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	78	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	71	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100	29	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent
Stability - Incubation	Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	60%	100	0	%	50 mM imidazole	6.5	50°C	0.2% volume THBA 3-Cyclohexene-1-carboxaldehyde	3-Cyclohexene-1-methanol	0.1 mM NADPH	—	Non-incubated control (in %), activity measured in the presence of organic solvent for both control and residual activity \| Uncertainty about whether control was really measured in the presence of organic solvent

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*