Cytochrome P450 CYP102A1 from Priestia megaterium

Enzyme Description

Species

Extremophile

EC Number

1.11.1.- ↗

Sequence

Length: 471 amino acids

TIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKASGEQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGIPSPSTEQSAKKVR

Kersten S. Rabe et al. (2010) — Peroxidase activity of bacterial cytochrome P450 enzymes: Modulation by fatty acids and organic solvents

Biotechnology Journal · doi:10.1002/biot.201000028 ↗ · Activity - Classical

4 measurements ▼

Database ID

UniProt: P14779 ↗

Sequence Annotation

Inferred (only P450 domain, residues 2-472 from the UniProt sequence)

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (4 measurements)

4 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Methanol	10%	0.0022	0.0021	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O , Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Ethanol	10%	0.0022	0.0019	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O , Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Isopropanol	10%	0.0022	0.0047	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O , Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Acetonitrile	10%	0.0022	0.0039	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O , Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice

Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Methanol	10%	0.0022	0.0021	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O, Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Ethanol	10%	0.0022	0.0019	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O, Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Isopropanol	10%	0.0022	0.0047	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O, Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice
Activity - Classical	Activity (in nmol substrate per nmol enzyme per second) measured by fluorescence spectrophotometry (resorufin fluorescence measurement) in the presence of organic solvent	Acetonitrile	10%	0.0022	0.0039	nmol substrate per nmol enzyme per second	50 mM potassium phosphate buffer	7	25°C	1 µM Amplex red, 1 mM H₂O₂ (Hydrogen Peroxide)	H2O, Resorufin	—	—	Classical aqueous control (in nmol substrate per nmol enzyme per second)) \| Here peroxidase activity measured, hence the EC number choice

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*