Short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius

Enzyme Description

Extremophile
Yes "thermoacidophilic" organism
EC Number

Sequence

Length: 264 amino acids
MDIDRLFSVKGMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDIDEEGLKRLSDSLRSRGHEVNHMKCDITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNFMVVKEFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKYNIRVNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYITGTVIYVDGGWTAIDGRYDPKV
Angela Pennacchio et al. (2010) β€” Biochemical characterization of a recombinant short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius
Extremophiles  Β· doi:10.1007/s00792-009-0298-3 β†—  Β· Stability - Incubation
34 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (34 measurements)

34 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 17% 115 116 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 17% 115 109 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 17% 103 151 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 30% 115 147 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 30% 103 181 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 17% 115 138 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 17% 103 159 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 30% 115 148 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 30% 103 214 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane 30% 103 166 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 17% 103 146 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30% 115 87 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30% 103 114 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 17% 115 135 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 17% 103 167 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 30% 115 36 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 30% 103 39 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 30% 103 187 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 7% 103 120 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 17% 115 126 % 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
β€Ή Prev
1 2

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*