Lipase (gene LipTth) from Thermoanaerobacter thermohydrosulfuricus SOL1

Enzyme Description

Species
Thermoanaerobacter thermohydrosulfuricus SOL1 β†—
Extremophile
Yes "extreme thermophilic" organism
EC Number
3.1.1.3 β†—

Sequence

Length: 259 amino acids
MQKAVEITYNGKTLRGMMHLPDDVKGKVPMVIMFHGFTGNKVESHFIFVKMSRALEKVGIGSVRFDFYGSGESDGDFSEMTFSSELEDARQILKFVKEQPTTDPERIGLLGLSMGGAIAGIVAREYKDEIKALVLWAPAFNMPELIMHESVKQYGAIMEQLGFVDIGGHKLSKDFVEDISKLNIFELSKGYDKKVLIVHGTNDEAVEYKVSDRILKEVYGDNATRVTIENADHTFKSLEWEKKAIEESVEFFKKELLKG
Marina Royter et al. (2009) β€” Thermostable lipases from the extreme thermophilic anaerobic bacteria Thermoanaerobacter thermohydrosulfuricus SOL1 and Caldanaerobacter subterraneus subsp. tengcongensis
Extremophiles  Β· doi:10.1007/s00792-009-0265-z β†—  Β· Stability - Incubation
18 measurements ▼
Database ID
UniProt: A0A1G7VV58 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli TunerTM(DE3)pLacI

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 99% 100 56 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Benzene 99% 100 0 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Toluene 99% 100 18 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Decanol 99% 100 34 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Pentanol 99% 100 39 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isooctane 99% 100 68 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexane 99% 100 77 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Heptane 99% 100 76 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase n-Hexadecane 99% 100 79 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 99% 100 113 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethylformamide (DMF) 99% 100 80 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 99% 100 105 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 99% 100 0 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 106 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Pyridine 99% 100 93 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 99% 100 96 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 99% 100 110 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (90 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 99% 100 76 % Incubation: ?, Assay: 0.025 M Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 70Β°C 0.07 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*