Lipase from Bacillus licheniformis RSP-09
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
AEHNPVVMVHGMGGASYNFASIKRYLVSQGWDQNQLFAIDFIDKTGNNLNNGPRLSRFVKDVLAKTGAKKVDIVAHSMGGANTLYYIKNLDGGDKIENVVTLGGANGLVSLRALPGTDPNQKILYTSVYSSADLIVVNSLSRLIGARNVLIHGVGHIGLLTSSQVKGYVKEGLNSGGQNTN
Bhawna Madan et al. (2009)
β Overexpression, Purification and Characterization of Organic Solvent Stable Lipase from Bacillus licheniformis RSP-09
Microbial Physiology
Β· doi:10.1159/000208523 β
Β· Activity + Stability - Incubation
▼
Database ID
UniProt: B2L2K1 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isooctane | 25% | 100 | 54 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | n-Hexane | 25% | 100 | 65 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Toluene | 25% | 100 | 58 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Benzene | 25% | 100 | 53 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetonitrile | 25% | 100 | 23 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 25% | 100 | 57 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
| Activity + Stability - Incubation | Activity after incubation (10 hours at 37Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 25% | 100 | 96 | % | Incubation: 50 mM sodium carbonate buffer, Assay: 0.1 MM sodium carbonate buffer | Incubation: 10, Assay: 10 | Incubation: 37Β°C, Assay: 37Β°C | 0.8 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | Yes, "mixture incubated in rotary shaker" | Non-incubated control (in %), residual activity | Uncertainty about whether organic solvent was present in the assay mixture, here indicated as yes ("lipase was found to retain 54% of its activity in [organic solvent]") |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.