Arylesterase from Sulfolobus solfataricus DSM1616

Enzyme Description

Species
Sulfolobus solfataricus DSM1616 β†—
Extremophile
Yes "thermoacidophilic" organism
EC Number
3.1.1.2 β†—

Sequence

Length: 306 amino acids
MPLDPEVRNFLQVYYKANIIDFTKYQFQEIRQKVNELLAKAVPKDPVGETRDMKIKLEDYELPIRIYSPIKRTNNGLVMHFHGGAWILGSIETEDAISRILSNSCECTVISVDYRLAPEYKFPTAVYDCFNAIVWARDNAGELGIDKDKIATFGISAGGNLVAATSLLARDNKLKLTAQVPVVPFVYLDLASKSMNRYRKGYFLDINLPVDYGVKMYIRDEKDLYNPLFSPLIAEDLSNLPQAIVVTAEYDPLRDQGEAYAYRLMESGVPTLSFRVNGNVHAFLGSPRTSRQVTVMIGALLKDIFK
Young-Jun Park et al. (2008) β€” A Novel Thermostable Arylesterase from the Archaeon Sulfolobus solfataricus P1: Purification, Characterization, and Expression
Journal of Bacteriology  Β· doi:10.1128/JB.00803-08 β†—  Β· Stability - Incubation
20 measurements ▼
Database ID
UniProt: B5BLW5 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Purified, archaeon Sulfolobus solfataricus DSM1616

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Methanol 50% 100 76 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 90% 100 71 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 97 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Acetonitrile 90% 100 43 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Acetonitrile 50% 100 61 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Isopropanol 90% 100 55 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Isopropanol 50% 100 86 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Ethanol 90% 100 63 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Ethanol 50% 100 78 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Methanol 90% 100 48 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 70Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Methanol 50% 100 106 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 90% 100 110 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 121 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Acetonitrile 90% 100 86 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Acetonitrile 50% 100 92 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Isopropanol 90% 100 92 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Isopropanol 50% 100 108 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Ethanol 90% 100 98 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Ethanol 50% 100 115 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 30Β°C) measured by absorbance spectrophotometry (phenol absorbance measurement, 270 nm) in aqueous phase Methanol 90% 100 96 % Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 30Β°C, Assay: 60Β°C 0.5 mM Phenyl acetate Acetic Acid , Phenol β€” β€” Water-incubated control (in %), activity measured in the absence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*