Metalloprotease from Pseudomonas aeruginosa MN7

Enzyme Description

Species
Pseudomonas aeruginosa MN7 β†—
Extremophile
No
EC Number
3.4.24.- β†—

Sequence

Length: 301 amino acids
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNGSTNDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFNLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVISSAQNRNYSAADVTRAFSTVGVTCPSAL
Kemel Jellouli et al. (2008) β€” Purification, biochemical and molecular characterization of a metalloprotease from Pseudomonas aeruginosa MN7 grown on shrimp wastes
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-008-1517-z β†—  Β· Stability - Incubation Stability - Half-life
10 measurements ▼
Database ID
UniProt: Q3Y6H8 β†—
Sequence Annotation
Explicit (197 first residues from UniProt sequence not present in mature protein)
Protein Source
Purified, bacterium Pseudomonas aeruginosa MN7

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm) in aqueous phase Methanol 25% 34.0 >60.0 days Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Classical aqueous control (in days), activity measured in the absence of organic solvent | Control : half-life in aquous buffer
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 25% 34.0 >60.0 days Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Classical aqueous control (in days), activity measured in the absence of organic solvent | Control : half-life in aquous buffer
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm) in aqueous phase Ethanol 25% 34.0 49.6 days Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Classical aqueous control (in days), activity measured in the absence of organic solvent | Control : half-life in aquous buffer
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm) in aqueous phase Dimethylformamide (DMF) 25% 34.0 39.0 days Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Classical aqueous control (in days), activity measured in the absence of organic solvent | Control : half-life in aquous buffer
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm) in aqueous phase Isopropanol 25% 34.0 28.9 days Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Classical aqueous control (in days), activity measured in the absence of organic solvent | Control : half-life in aquous buffer
Stability - Incubation Activity after incubation (60 days at 30Β°C), measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm), in aqueous phase Methanol 25% 16.0 100.0 % Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Water-incubated control (in %), activity measured in the absence of organic solvent | Control : percentage residual activity after incubation in aquous buffer
Stability - Incubation Activity after incubation (60 days at 30Β°C), measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm), in aqueous phase Dimethyl Sulfoxide (DMSO) 25% 16.0 100.0 % Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Water-incubated control (in %), activity measured in the absence of organic solvent | Control : percentage residual activity after incubation in aquous buffer
Stability - Incubation Activity after incubation (60 days at 30Β°C), measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm), in aqueous phase Ethanol 25% 16.0 40.0 % Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Water-incubated control (in %), activity measured in the absence of organic solvent | Control : percentage residual activity after incubation in aquous buffer
Stability - Incubation Activity after incubation (60 days at 30Β°C), measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm), in aqueous phase Dimethylformamide (DMF) 25% 16.0 22.4 % Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Water-incubated control (in %), activity measured in the absence of organic solvent | Control : percentage residual activity after incubation in aquous buffer
Stability - Incubation Activity after incubation (60 days at 30Β°C), measured by absorbance spectrophotometry (tyrosine absorbance measurement, 280 nm), in aqueous phase Isopropanol 25% 16.0 9.7 % Incubation: 100 mM Tris–HCl, Assay: 100 mM Tris–HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” Incubation: 150 rpm Water-incubated control (in %), activity measured in the absence of organic solvent | Control : percentage residual activity after incubation in aquous buffer

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*