Glyceraldehyde-3-phosphate dehydrogenase from Trypanosoma cruzi

Enzyme Description

Species
Trypanosoma cruzi β†—
Extremophile
No
EC Number
1.2.1.12 β†—

Sequence

Length: 359 amino acids
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
H.J. Wiggers et al. (2007) β€” Effects of organic solvents on the enzyme activity of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase in calorimetric assays
Analytical Biochemistry  Β· doi:10.1016/j.ab.2007.06.042 β†—  Β· Activity - Classical Activity - Michaelis-Menten
18 measurements ▼
Database ID
UniProt: P22513 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 7.5% 100.0 121.0 % 100 mM TEA-HCl buffer 7.5 25Β°C 1 mM Glyceraldehyde 3-phosphate, 30 mM NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 115.0 % 100 mM TEA-HCl buffer 7.5 25Β°C 1 mM Glyceraldehyde 3-phosphate, 30 mM NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2.5% 100.0 107.0 % 100 mM TEA-HCl buffer 7.5 25Β°C 1 mM Glyceraldehyde 3-phosphate, 30 mM NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in %)
Activity - Michaelis-Menten Km (Β΅M) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 7.5% 39.3 3.71 Β΅M 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in microM)
Activity - Michaelis-Menten kcat/Km*10^6 (1/(s*M)) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 7.5% 1.81 49.6 10^6 * 1/(s * M) 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 10^6 * 1/(s * M))
Activity - Michaelis-Menten kcat/Km*10^6 (1/(s*M)) in the presence of organic solvent, measured by isothermal titration calorimetry Methanol 5% 1.81 43.5 10^6 * 1/(s * M) 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 10^6 * 1/(s * M))
Activity - Michaelis-Menten kcat/Km*10^6 (1/(s*M)) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 5% 1.81 10.9 10^6 * 1/(s * M) 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 10^6 * 1/(s * M))
Activity - Michaelis-Menten kcat/Km*10^6 (1/(s*M)) in the presence of organic solvent, measured by isothermal titration calorimetry Methanol 2.5% 1.81 21.3 10^6 * 1/(s * M) 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 10^6 * 1/(s * M))
Activity - Michaelis-Menten kcat/Km*10^6 (1/(s*M)) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 2.5% 1.81 3.38 10^6 * 1/(s * M) 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 10^6 * 1/(s * M))
Activity - Michaelis-Menten kcat (1/s) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 2.5% 71.4 87.4 1/s 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten Km (Β΅M) in the presence of organic solvent, measured by isothermal titration calorimetry Methanol 5% 39.3 10.2 Β΅M 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in microM)
Activity - Michaelis-Menten Km (Β΅M) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 5% 39.3 10.8 Β΅M 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in microM)
Activity - Michaelis-Menten Km (Β΅M) in the presence of organic solvent, measured by isothermal titration calorimetry Methanol 2.5% 39.3 11.8 Β΅M 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in microM)
Activity - Michaelis-Menten Km (Β΅M) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 2.5% 39.3 25.8 Β΅M 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in microM)
Activity - Michaelis-Menten kcat (1/s) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 7.5% 71.4 184.0 1/s 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (1/s) in the presence of organic solvent, measured by isothermal titration calorimetry Methanol 5% 71.4 442.0 1/s 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (1/s) in the presence of organic solvent, measured by isothermal titration calorimetry Dimethyl Sulfoxide (DMSO) 5% 71.4 118.0 1/s 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (1/s) in the presence of organic solvent, measured by isothermal titration calorimetry Methanol 2.5% 71.4 249.0 1/s 100 mM TEA-HCl buffer 7.5 25Β°C Glyceraldehyde 3-phosphate, NaHAsO4 1-arseno- 3-phosphoglycerate 1.5 mM NAD+ β€” Classical aqueous control (in 1/s)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*