Esterase A from Paenarthrobacter nitroguajacolicus

Enzyme Description

Species
Paenarthrobacter nitroguajacolicus β†—
Extremophile
No
EC Number
3.1.1.1 β†—

Sequence

Length: 372 amino acids
MHSQVIAPGFEPVAELFGVFLEQDPDYSAQVAAYHRGVKVLDLSGGPHIRPDSVTGVFSCSKGMAGLVMALLVQDGELDLEAEVVKYWPEFGVEGKSSITVAQLLSHRAGLLGVEGGLTLHEVNNSELAAAKLAELPPLWKPGTAFGYHALTIGIFMEELCRRITGSTLQEVFEQRIRAVTGANFYLGLPESEESRFAQFRWAADPSWPWVDPASHFGLAANAAVGDILDLPNIREVRAAGLSSAAGVASAEGMARIYAAALTGLEGKSAMPPLLTEETIRTVSAEQVFGIDRVFGETGCFGTVFMKSHTRMPFGSYRAFGHDGASASLGFADPVYELGFGYVPQTAEPGGVGCRNFQLSSAVREVIAGFAA
Marcus SchΓΌtte et al. (2007) β€” EstA from Arthrobacter nitroguajacolicus RΓΌ61a, a Thermo- and Solvent-Tolerant Carboxylesterase Related to Class C Ξ²-Lactamases
Current Microbiology  Β· doi:10.1007/s00284-006-0438-2 β†—  Β· Stability - Incubation Activity + Stability - Incubation
14 measurements ▼
Database ID
UniProt: K4DIE4 β†—
Sequence Annotation
Explicit - provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100 110 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Dimethylformamide (DMF) 30% 100 108 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Methanol 30% 100 115 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Acetonitrile 30% 100 120 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Ethanol 30% 100 90 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Acetone 30% 100 130 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Activity + Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent 1-Propanol 30% 100 104 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), in the presence of organic solvent Diethyl Ether 30% 100 124 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent Chloroform 5% 100 0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent Toluene 5% 100 0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent n-Hexane 5% 100 0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent n-Octane 5% 100 0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent n-Dodecane 5% 100 0 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"
Stability - Incubation Activity after incubation (20 minutes at 22Β°C), measured by absorbance spectrophotometry (phenol absorbance measurement, 269 nm), without the presence of organic solvent n-Hexadecane 5% 100 51 % Incubation: 50 mM sodium phosphate buffer, Assay: 50 mM sodium phosphate buffer Incubation: 8, Assay: 8 Incubation: 22Β°C, Assay: 22Β°C 5 mM Phenyl acetate Acetic Acid , Phenol β€” Incubation: 200 rpm Water-incubated control (in %) | Residual activity measured in water for immiscible solvents, in organic solvent for miscible ones, "The activity of an enzyme sample incubated in buffer for 20 min at 200 rpm was defined as 100%"

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*