Ene-reductase RmER from Cupriavidus metallidurans

Enzyme Description

Species

Extremophile

EC Number

1.6.99.1 ↗

Sequence

Length: 371 amino acids

MPHLFDPYRIGNLELANRIAIAPMCQYSAQEGNATDWHMIHLGQMALSGAGLLIIEATAVSPEGRITPTDLGLYNDANEAALGRVLGAVRNHSPIAVTIQLAHAGRKASSEAPWDGGGQIRPDQPRGWQTFAPSAVPHAAGEVPPAALDKAGMKKIRDDFVAAAKRAARLGIEGIEVHGAHGYLLHQFLSPIANHRTDEYGGSLENRMRFPLEVFDAVREAFPAERPVWMRVSATDWVPNGWDIEGTIALSHELKARGSAAVHVSTGGVSPQQAIKIGPGYQVPYAQRVKAEVGLPTMAVGLITEAEQAEAIIANNEADIISIARAMLYDPRWPWHAAAKLGASVNAPKQYWRSQPRGLEKLFKDAHFGQR

Frieda A. Sorgenfrei et al. (2024) — Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification

Nature Communications · doi:10.1038/s41467-024-49774-0 ↗ · Activity - Classical Stability - Tm

60 measurements ▼

Database ID

UniProt: Q1LDQ5 ↗

Sequence Annotation

Explicit - Provided UniProt Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (60 measurements)

60 measurements — page 3 of 3

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	25%	51.33	33.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	30%	51.33	30.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	5%	51.33	48.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	10%	51.33	45.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	15%	51.33	42.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	51.33	48.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	25%	51.33	36.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	30%	51.33	33.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	5%	51.33	44.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	10%	51.33	38.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	15%	51.33	36.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	20%	51.33	33.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	25%	51.33	28.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	30%	51.33	24.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	5%	51.33	43.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	10%	51.33	34.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	15%	51.33	28.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	20%	51.33	27.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	25%	51.33	22.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	30%	51.33	27.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)

Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	95.9	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	120.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	125.4	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	119.6	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	108.7	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	68.1	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	96.3	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	92.6	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	89.4	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	82.4	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	63.3	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	11.7	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	102.3	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	102.3	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	100.0	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	124.6	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	88.4	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	80.8	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	5%	100.0	98.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	10%	100.0	102.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	15%	100.0	96.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	20%	100.0	87.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	25%	100.0	48.1	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	30%	100.0	2.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	5%	100.0	105.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	10%	100.0	93.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	15%	100.0	62.1	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	20%	100.0	0.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	25%	100.0	0.8	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	30%	100.0	2.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	20%	51.33	39.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	51.33	46.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	51.33	43.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	51.33	41.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	51.33	39.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	51.33	38.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	5%	51.33	47.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	10%	51.33	41.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	15%	51.33	39.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	20%	51.33	36.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	25%	51.33	33.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	30%	51.33	30.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	5%	51.33	48.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	10%	51.33	45.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	15%	51.33	42.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	51.33	48.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	25%	51.33	36.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	30%	51.33	33.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	5%	51.33	44.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	10%	51.33	38.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	15%	51.33	36.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	20%	51.33	33.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	25%	51.33	28.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	30%	51.33	24.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	5%	51.33	43.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	10%	51.33	34.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	15%	51.33	28.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	20%	51.33	27.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	25%	51.33	22.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	30%	51.33	27.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)

‹ Prev

1 2 3

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*