Fructose bisphosphate aldolase from Edwardsiella ictaluri

Enzyme Description

Species

Extremophile

EC Number

4.1.2.13 ↗

Sequence

Length: 357 amino acids

SKIFDFVKPGVIFGDDVQKVFQVAKENKFALPAVNCVGTDSINAVMEAAAKVRAPIIVQFSNGGAAFIAGKGLKLEGQQGAILGAIAGAHHVHQMAEYYGVPVILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSQYLARMSKIGMTLELELGCTGGEEDGVDNSHLDNSALYTQPEDVDYAFTKLSAISPRFTIAASFGNVHGVYKPGNVQLTPVILKNSQEYVSKKHNLPHNSLNFVFHGGSGSTAAEIKEAVSYGVVKMNIDTDTQWATWEGVLKYYKKNEGYLQGQLGNPEGDDKPNKKYYDPRVWLRAAQTGMIERLEQAFKELNCIDVL

J. Hao et al. (2004) — A thermostable variant of fructose bisphosphate aldolase constructed by directed evolution also shows increased stability in organic solvents

Protein Engineering Design and Selection · doi:10.1093/protein/gzh081 ↗ · Stability - Incubation Activity + Stability - Incubation

24 measurements ▼

Database ID

UniProt: O52402 ↗

Sequence Annotation

Explicit - Provided (first residue from UniProt sequence absent from the mature protein)

Protein Source

Recombinant, host bacterium Escherichia coli KM3

Experimental Data (24 measurements)

24 measurements — page 2 of 2

Mutation	Property	Assay	Solvent	Solvent Volume	Aqueous Reference	WT Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Dimethylformamide (DMF)	20%	96	20	102	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Acetonitrile	20%	96	7	89	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Chloroform	20%	96	50	97	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Methanol	20%	96	50	103	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase

WT	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Toluene	20%	79	—	60	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
WT	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	n-Hexane	20%	79	—	64	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
WT	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Dimethylformamide (DMF)	20%	79	—	4	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
WT	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Acetonitrile	20%	79	—	18	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
WT	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Chloroform	20%	79	—	21	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
WT	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Methanol	20%	79	—	58	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Methanol	20%	79	—	50	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
WT	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Chloroform	20%	79	—	50	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
WT	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Acetonitrile	20%	79	—	7	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
WT	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Dimethylformamide (DMF)	20%	79	—	20	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
WT	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	n-Hexane	20%	79	—	66	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
WT	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Toluene	20%	79	—	57	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Toluene	20%	96	60	86	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Methanol	20%	96	58	102	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Chloroform	20%	96	21	84	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Acetonitrile	20%	96	18	53	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	Dimethylformamide (DMF)	20%	96	4	8	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Activity + Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent	n-Hexane	20%	96	64	87	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Toluene	20%	96	57	102	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	n-Hexane	20%	96	66	100	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Dimethylformamide (DMF)	20%	96	20	102	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Acetonitrile	20%	96	7	89	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Chloroform	20%	96	50	97	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R	Stability - Incubation	Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase	Methanol	20%	96	50	103	%	Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate	Incubation: 8, Assay: 8	Incubation: Room temperature, Assay: 30°C	4 mM Fructose 1,6-biphosphate	Dihydroxyacetone phosphate, Glyceraldehyde-3-phosphate	—	—	Water-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase

‹ Prev

1 2

Next ›

Mutations in this dataset (2)

WT V45A/K71I/Q79L/A111T/A124V/A210V/Q346R

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Activity + Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Fructose bisphosphate aldolase from Edwardsiella ictaluri

Enzyme Description

Sequence

Experimental Data (24 measurements)

Visualization : Stability — Incubation

Mutation Effect

Visualization : Activity + Stability — Incubation

Mutation Effect

Structure

Loading…