Ene-reductase OYE1 from Saccharomyces pastorianus

Enzyme Description

Species

Extremophile

EC Number

1.6.99.1 ↗

Sequence

Length: 400 amino acids

MSFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK

Frieda A. Sorgenfrei et al. (2024) — Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification

Nature Communications · doi:10.1038/s41467-024-49774-0 ↗ · Activity - Classical Stability - Tm

150 measurements ▼

Database ID

UniProt: Q02899 ↗

Sequence Annotation

Explicit - Provided UniProt Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (150 measurements)

150 measurements — page 8 of 8

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	15%	45.3	37.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	20%	45.3	34.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	25%	45.3	33.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	30%	45.3	28.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	5%	45.3	40.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	10%	45.3	34.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	15%	45.3	31.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	20%	45.3	31.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	25%	45.3	30.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	30%	45.3	27.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)

Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	109.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	103.1	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	100.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	105.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	100.8	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	100.8	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	106.0	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	119.5	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	132.2	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	134.2	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	140.9	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	165.1	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	111.0	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	116.8	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	133.5	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	143.9	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	156.1	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	166.5	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	5%	100.0	126.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	10%	100.0	139.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	15%	100.0	152.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	20%	100.0	147.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	25%	100.0	163.9	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	30%	100.0	168.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	5%	100.0	122.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	10%	100.0	140.8	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	15%	100.0	139.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	20%	100.0	143.1	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	25%	100.0	141.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	30%	100.0	150.8	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	140.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	135.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	160.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	180.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	135.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	75.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	35.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	10.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	5.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	139.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	160.9	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	156.5	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	152.2	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	91.3	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	65.2	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	13.0	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	8.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	17.4	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	130.6	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	144.4	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	144.4	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	88.9	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	8.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	5.6	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	2.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	2.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	5.6	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	103.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	63.6	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	27.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	6.1	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	3.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	3.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	3.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	3.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	3.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	170.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	120.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	50.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	20.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	10.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	20.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	30.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	10.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	20.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	87.5	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	125.0	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	137.5	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	154.2	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	129.2	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	79.2	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	12.5	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	8.3	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	4.2	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	138.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	171.4	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	190.5	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	204.8	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	142.9	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	66.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	19.0	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	14.3	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	14.3	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	124.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	140.5	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	148.6	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	108.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	16.2	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	2.7	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	2.7	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	0.0	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	2.7	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	108.7	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	73.9	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	39.1	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	8.7	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	8.7	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	4.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	0.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	4.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	4.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	171.4	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	114.3	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	57.1	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	14.3	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	28.6	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	0.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	0.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	14.3	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	0.0	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	45.3	44.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	45.3	43.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	45.3	42.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	45.3	40.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	45.3	39.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	45.3	37.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	5%	45.3	43.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	10%	45.3	42.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	15%	45.3	39.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	20%	45.3	37.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	25%	45.3	35.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	30%	45.3	34.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	5%	45.3	45.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	10%	45.3	43.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	15%	45.3	42.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	20%	45.3	40.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	25%	45.3	37.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	30%	45.3	34.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	5%	45.3	44.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	10%	45.3	41.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	15%	45.3	37.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	20%	45.3	34.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	25%	45.3	33.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	30%	45.3	28.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	5%	45.3	40.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	10%	45.3	34.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	15%	45.3	31.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	20%	45.3	31.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	25%	45.3	30.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	30%	45.3	27.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)

‹ Prev

1 … 5 6 7 8

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*