Ξ²-trypsin from Bos taurus (bovine)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 223 amino acids
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Dayanne Pinho Rosa et al. (2021) β€” Evaluation of biological activities, structural and conformational properties of bovine beta- and alpha-trypsin isoforms in aqueous-organic media
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2021.02.079 β†—  Β· Activity - Classical Stability - Tm
33 measurements
Database ID
UniProt: P00760 β†—
Sequence Annotation
Inferred - from protein name (23 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased

Experimental Data (33 measurements)

33 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Methanol 70% 46.0 0.0 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Methanol 80% 46.0 0.0 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Methanol 90% 46.0 0.0 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Ethanol 10% 46.0 51.6 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Ethanol 20% 46.0 56.5 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Ethanol 30% 46.0 55.5 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Ethanol 40% 46.0 54.9 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 410 nm) in the presence of organic solvent Ethanol 60% 46.0 3.0 Β΅M/L 100 mM Tris-HCl buffer, 20 mM CaCl2 8 37Β°C 0.9 mM Benzoyl-DL-arginine p-nitroanilide N-Benzoyl-L-arginine , p-Nitroaniline β€” β€” Classical aqueous control (in microM/L)
Stability - Tm Tm measured by UV-absorption spectroscopy in the presence of organic solvent Ethanol 20% 56.5 43.2 Β°C 50 mM glycine buffer, 20 mM CaCl2 3 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by UV-absorption spectroscopy in the presence of organic solvent Ethanol 40% 56.5 48.8 Β°C 50 mM glycine buffer, 20 mM CaCl2 3 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by UV-absorption spectroscopy in the presence of organic solvent Ethanol 50% 56.5 48.2 Β°C 50 mM glycine buffer, 20 mM CaCl2 3 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by UV-absorption spectroscopy in the presence of organic solvent Ethanol 60% 56.5 53.4 Β°C 50 mM glycine buffer, 20 mM CaCl2 3 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by UV-absorption spectroscopy in the presence of organic solvent Ethanol 80% 56.5 68.6 Β°C 50 mM glycine buffer, 20 mM CaCl2 3 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*