E.Coli-expressed hydroxynitrile lyase (gene PeHNL) from Passiflora edulis (passion fruit)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 147 amino acids
MRNPGASFLIKHFLVLSLFLCAGTAHNPPEIVRHIVFNRYKSQLSQKQIDQIIADYGNLQNIAPEMKEWKWGTDLGPAVEDRADGFTHAYESTFHSVADFLNFFYSPPALEFAKEFFPACEKIVVLNYIINETFPYTWALPNKYVVT
Aem Nuylert et al. (2017) β€” Effect of Glycosylation on the Biocatalytic Properties of Hydroxynitrile Lyase from the Passion Fruit, Passiflora edulis : A Comparison of Natural and Recombinant Enzymes
ChemBioChem  Β· doi:10.1002/cbic.201600447 β†—  Β· Stability - Incubation Selectivity - Enantioselectivity
12 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Ethyl Acetate 50% 51.8 84.5 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Diethyl Ether 50% 51.8 96.6 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC tert-Butyl Methyl Ether (MTBE) 50% 51.8 94.4 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Diisopropyl Ether 50% 51.8 94.9 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Butyl Ether 50% 51.8 91.3 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC n-Hexane 50% 51.8 31.2 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Ethyl Acetate 50% 53.4 1.9 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Diethyl Ether 50% 53.4 4.1 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent tert-Butyl Methyl Ether (MTBE) 50% 53.4 25.3 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Diisopropyl Ether 50% 53.4 20.1 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Butyl Ether 50% 53.4 52.9 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent n-Hexane 50% 53.4 69.4 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Structure

🧬

No structure available for this protein.