Halohydrin dehalogenase (gene HHDH) from Agrobacterium radiobacter AD1

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 254 amino acids
MSTAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMPE
Nevena MilčiΔ‡ et al. (2022) β€” Inhibitory Effect of DMSO on Halohydrin Dehalogenase: Experimental and Computational Insights into the Influence of an Organic Co-solvent on the Structural and Catalytic Properties of a Biocatalyst
Chemistry–A European Journal  Β· doi:10.1002/chem.202201923 β†—  Β· Activity - Classical Stability - deltaHTm Stability - Inactivation Rate Constant Stability - Incubation Stability - Tm Stability - Half-life
73 measurements
Database ID
UniProt: Q93D82 β†—
Sequence Annotation
Explicit - Provided PDB Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli MC1061

Experimental Data (73 measurements)

73 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 5.2 1.1 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 4 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 5.2 1.9 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 4 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 5.2 3.0 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 4 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 2.8 1.6 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 3 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 2.8 0.9 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 3 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.8 0.6 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 3 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 2.8 0.3 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 3 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 35% 2.8 0.3 U/mg 100 mM Tris-SO4 buffer 7.5 25Β°C 3 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Stability - Ξ”HTm Ξ΄ HTM measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40% 509.0 358.0 kJ/mol 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in kJ/mol) | Enzyme cell-free extracts used for measurements
Stability - Ξ”HTm Ξ΄ HTM measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 509.0 517.0 kJ/mol 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in kJ/mol) | Enzyme cell-free extracts used for measurements
Stability - Ξ”HTm Ξ΄ HTM measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 509.0 502.0 kJ/mol 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in kJ/mol) | Enzyme cell-free extracts used for measurements
Stability - Ξ”HTm Ξ΄ HTM measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 509.0 513.0 kJ/mol 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in kJ/mol) | Enzyme cell-free extracts used for measurements
Stability - Ξ”HTm Ξ΄ HTM measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 509.0 175.0 kJ/mol 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in kJ/mol) | Enzyme cell-free extracts used for measurements
Stability - Half-life Half-life (in hours), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethylformamide (DMF) 50% 520.0 0.51 hours Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Classical aqueous control (in hours) | Enzyme cell-free extracts used for measurements
Stability - Half-life Half-life (in hours), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethylformamide (DMF) 35% 520.0 0.57 hours Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Classical aqueous control (in hours) | Enzyme cell-free extracts used for measurements
Stability - Half-life Half-life (in hours), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethylformamide (DMF) 20% 520.0 1.0 hours Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in hours) | Enzyme cell-free extracts used for measurements
Stability - Half-life Half-life (in hours), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethyl Sulfoxide (DMSO) 50% 520.0 0.7 hours Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Classical aqueous control (in hours) | Enzyme cell-free extracts used for measurements
Stability - Half-life Half-life (in hours), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethyl Sulfoxide (DMSO) 40% 520.0 41.0 hours Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Classical aqueous control (in hours) | Enzyme cell-free extracts used for measurements
Stability - Half-life Half-life (in hours), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethyl Sulfoxide (DMSO) 30% 520.0 484.0 hours Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Classical aqueous control (in hours) | Enzyme cell-free extracts used for measurements
Stability - Inactivation Rate Constant Deactivation constant (in 1/min), determined by residual activity measurements (HPLC) after incubation at 25Β°C Dimethyl Sulfoxide (DMSO) 40% 2.22*10^-5 2.81*10^-4 1/min Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Classical aqueous control (in 1/min) | Enzyme cell-free extracts used for measurements
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Ξ”HTm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Inactivation Rate Constant

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*