4-oxalocrotonate tautomerase from Pseudomonas putida

Enzyme Description

Extremophile
No
EC Number
5.3.2.6 β†— (natural activity but non-natural Michaelis addition activity evaluated)

Sequence

Length: 62 amino acids
PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRR
Chao Guo et al. (2020) β€” Tuning Enzyme Activity for Nonaqueous Solvents: Engineering an Enantioselective "Michaelase" for Catalysis in High Concentrations of Ethanol
ChemBioChem  Β· doi:10.1002/cbic.201900721 β†—  Β· Activity - Classical
1104 measurements
Database ID
UniProt: Q01468 β†—
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence removed from mature protein, 1 mutation)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (1104 measurements)

1104 measurements β€” page 54 of 56
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 51.0 75.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% ethanol | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 40% 100.0 18.0 44.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% ethanol | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 15% 100.0 56.0 70.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 25% 100.0 37.0 52.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 40% 100.0 9.0 37.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 15% 100.0 56.0 77.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 25% 100.0 37.0 58.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 40% 100.0 9.0 25.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 15% 100.0 56.0 59.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 25% 100.0 37.0 52.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Methanol 40% 100.0 9.0 13.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 15% 100.0 83.0 94.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 25% 100.0 63.0 84.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 40% 100.0 45.0 51.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 15% 100.0 83.0 92.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 25% 100.0 63.0 85.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 40% 100.0 45.0 54.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 15% 100.0 83.0 100.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 25% 100.0 63.0 87.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent 1,3-Propanediol 40% 100.0 45.0 44.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
1 … 53 54 55 56
Mutations in this dataset (1036)

Visualization : Activity β€” Classical

Mutation Effect

Select a condition below. Conditions with >50 mutations show a heatmap, ranked lollipop, or ranked lollipop; others show paired bars per mutation.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*