4-oxalocrotonate tautomerase from Pseudomonas putida

Enzyme Description

Extremophile
No
EC Number
5.3.2.6 β†— (natural activity but non-natural Michaelis addition activity evaluated)

Sequence

Length: 62 amino acids
PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRR
Chao Guo et al. (2020) β€” Tuning Enzyme Activity for Nonaqueous Solvents: Engineering an Enantioselective "Michaelase" for Catalysis in High Concentrations of Ethanol
ChemBioChem  Β· doi:10.1002/cbic.201900721 β†—  Β· Activity - Classical
1104 measurements
Database ID
UniProt: Q01468 β†—
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence removed from mature protein, 1 mutation)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (1104 measurements)

1104 measurements β€” page 5 of 56
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
E17A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
T18A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 65.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
L19A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
I20A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
R21A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
E22A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
V23A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
S24A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 15.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
I27A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 15.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
S28A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 25.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
R29A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 25.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
S30A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
L31A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 0.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
D32A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
P34A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
L35A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 15.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
T36A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 15.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
S37A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 15.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
V38A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 50.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
R39A Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Ethanol 25% 100.0 50.0 0.0 % 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 0.5 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” 500 rpm for 60 first seconds Classical aqueous control (in %) in 5% ethanol | Categorical data/deducted temperature
1 … 4 5 6 … 56
Mutations in this dataset (1036)

Visualization : Activity β€” Classical

Mutation Effect

Select a condition below. Conditions with >50 mutations show a heatmap, ranked lollipop, or ranked lollipop; others show paired bars per mutation.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*