4-oxalocrotonate tautomerase from Pseudomonas putida

Enzyme Description

Species

Pseudomonas putida ↗

Extremophile

EC Number

5.3.2.6 ↗ (natural activity but non-natural Michaelis addition activity evaluated)

Sequence

Length: 62 amino acids

PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRR

Chao Guo et al. (2020) — Tuning Enzyme Activity for Nonaqueous Solvents: Engineering an Enantioselective "Michaelase" for Catalysis in High Concentrations of Ethanol

ChemBioChem · doi:10.1002/cbic.201900721 ↗ · Activity - Classical

1104 measurements ▼

Database ID

UniProt: Q01468 ↗

Sequence Annotation

Explicit - Provided (first residue from UniProt sequence removed from mature protein, 1 mutation)

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (1104 measurements)

1104 measurements — page 40 of 56

Mutation	Property	Assay	Solvent	Solvent Volume	Aqueous Reference	WT Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
G51S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	35.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature

WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	15%	100.0	—	80.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	—	51.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	40%	100.0	—	18.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	15%	100.0	—	56.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	25%	100.0	—	37.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	40%	100.0	—	9.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	15%	100.0	—	83.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	25%	100.0	—	63.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	40%	100.0	—	45.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	—	115.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	—	119.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	—	94.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	15%	100.0	—	104.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	25%	100.0	—	76.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	40%	100.0	—	19.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	15%	100.0	—	119.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
WT	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	25%	100.0	—	78.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
I2G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62G	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	5.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62A	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62V	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62I	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62L	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	5.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62M	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62F	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	35.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62W	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61E	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60R	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62H	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	35.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62K	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	35.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62S	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62T	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62N	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62Q	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A3C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G10C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S12C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	15.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
P34C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I2P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q4P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I5P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H6P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I7P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L8P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E9P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R11P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D13P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E14P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
Q15P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K16P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E17P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T18P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L19P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I20P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R21P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E22P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V23P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S24P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E25P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A26P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I27P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S28P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R29P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L31P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
D32P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A33P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L35P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T36P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S37P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V38P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R39P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V40P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I41P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I42P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
T43P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E44P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
M45P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A46P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K47P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G48P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
H49P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
F50P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G51P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
I52P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G53P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
G54P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
E55P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	0.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
L56P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
A57P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S58P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
K59P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
V60P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R61P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
R62P	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	50.0	50.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 0.5 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	500 rpm for 60 first seconds	Classical aqueous control (in %) in 5% ethanol \| Categorical data/deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	15%	100.0	80.0	92.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	51.0	65.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	40%	100.0	18.0	21.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	15%	100.0	80.0	102.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	51.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	40%	100.0	18.0	45.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	15%	100.0	80.0	106.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	25%	100.0	51.0	75.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Ethanol	40%	100.0	18.0	44.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% ethanol \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	15%	100.0	56.0	70.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	25%	100.0	37.0	52.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	40%	100.0	9.0	37.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	15%	100.0	56.0	77.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	25%	100.0	37.0	58.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	40%	100.0	9.0	25.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	15%	100.0	56.0	59.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	25%	100.0	37.0	52.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Methanol	40%	100.0	9.0	13.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	15%	100.0	83.0	94.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	25%	100.0	63.0	84.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	40%	100.0	45.0	51.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	15%	100.0	83.0	92.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	25%	100.0	63.0	85.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	40%	100.0	45.0	54.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	15%	100.0	83.0	100.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	25%	100.0	63.0	87.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	1,3-Propanediol	40%	100.0	45.0	44.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	115.0	146.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	119.0	198.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	94.0	178.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	115.0	110.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	119.0	133.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	94.0	118.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	115.0	126.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	119.0	164.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	94.0	188.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	15%	100.0	104.0	140.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	25%	100.0	76.0	132.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	40%	100.0	19.0	11.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	15%	100.0	104.0	115.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	25%	100.0	76.0	94.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	40%	100.0	19.0	44.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	15%	100.0	104.0	123.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	25%	100.0	76.0	110.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	Isopropanol	40%	100.0	19.0	3.5	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	15%	100.0	119.0	68.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30C	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	25%	100.0	78.0	52.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	15%	100.0	119.0	103.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
S30Y	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	25%	100.0	78.0	62.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	15%	100.0	119.0	114.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature
A33D	Activity - Classical	Activity of cell free extracts measured by absorbance spectrophotometry (decrease in β-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent	tert-Butanol	25%	100.0	78.0	18.0	%	20 mM sodium phosphate buffer	7.3	Room temperature	50 mM Acetaldehyde, 2 mM β-Nitrostyrene	(R)-4-Nitro-3-phenylButyraldehyde	—	—	Classical aqueous control (in %) in 5% organic solvent \| Deducted temperature

‹ Prev

1 … 39 40 41 … 56

Next ›

Mutations in this dataset (1036)

▼

WT I2A I2C I2D I2E I2F I2G I2K I2L I2M I2N I2P I2R I2S I2T I2V I2W I2Y A3C A3D A3E A3F A3G A3H A3I A3K A3L A3M A3N A3R A3S A3T A3V A3W A3Y Q4A Q4C Q4E Q4F Q4G Q4H Q4I Q4K Q4L Q4M Q4N Q4P Q4R Q4S Q4T Q4V Q4W Q4Y I5A I5E I5F I5G I5K I5L I5M I5P I5Q I5R I5S I5T I5V I5W I5Y H6A H6C H6D H6E H6F H6G H6I H6K H6L H6M H6N H6P H6Q H6R H6S H6T H6V H6W H6Y I7A I7C I7D I7E I7F I7G I7H I7K I7L I7P I7Q I7R I7S I7T I7V I7W I7Y L8A L8C L8E L8F L8G L8H L8I L8K L8M L8N L8P L8R L8S L8T L8V L8W L8Y E9A E9C E9D E9F E9G E9I E9K E9L E9M E9N E9P E9Q E9R E9S E9T E9V E9W E9Y G10A G10C G10D G10E G10F G10H G10I G10K G10L G10M G10N G10Q G10R G10S G10T G10V G10Y R11A R11C R11E R11F R11G R11I R11K R11L R11M R11N R11P R11Q R11S R11T R11V R11Y S12A S12C S12E S12F S12G S12I S12K S12L S12M S12N S12R S12T S12V S12W S12Y D13A D13E D13F D13G D13H D13I D13K D13L D13M D13P D13Q D13R D13S D13T D13V D13W D13Y E14A E14C E14F E14G E14H E14I E14K E14L E14M E14N E14P E14Q E14R E14S E14T E14V E14W Q15A Q15C Q15D Q15E Q15F Q15G Q15H Q15I Q15K Q15L Q15M Q15P Q15R Q15S Q15T Q15V Q15W Q15Y K16A K16C K16D K16E K16F K16G K16H K16L K16M K16P K16Q K16R K16S K16T K16V K16W K16Y E17A E17C E17D E17F E17G E17K E17L E17M E17N E17P E17Q E17R E17S E17T E17V E17W E17Y T18A T18C T18D T18E T18F T18G T18H T18I T18K T18L T18M T18P T18Q T18R T18S T18V T18W T18Y L19A L19D L19E L19F L19G L19I L19K L19M L19P L19Q L19R L19S L19T L19V L19W L19Y I20A I20C I20E I20F I20G I20H I20K I20L I20M I20P I20Q I20R I20S I20T I20V I20W I20Y R21A R21C R21D R21E R21F R21G R21H R21I R21K R21L R21M R21N R21P R21S R21T R21V R21W R21Y E22A E22C E22D E22F E22G E22I E22K E22L E22M E22N E22P E22R E22S E22T E22V E22W E22Y V23A V23C V23D V23E V23F V23G V23H V23I V23K V23L V23M V23P V23R V23S V23T V23W S24A S24C S24D S24E S24F S24G S24H S24I S24K S24L S24M S24P S24R S24T S24V S24W S24Y E25C E25D E25F E25G E25H E25I E25K E25L E25M E25N E25P E25Q E25R E25S E25T E25V E25W E25Y A26D A26E A26F A26G A26I A26K A26L A26M A26N A26P A26Q A26R A26S A26T A26V A26W A26Y I27A I27C I27E I27F I27G I27H I27K I27L I27M I27P I27Q I27R I27S I27T I27V I27W S28A S28C S28D S28F S28G S28H S28I S28K S28L S28M S28N S28P S28Q S28R S28T S28V S28W S28Y R29A R29C R29D R29F R29G R29H R29I R29K R29L R29M R29N R29P R29Q R29S R29T R29V R29W R29Y S30A S30C S30D S30E S30F S30H S30I S30K S30L S30M S30N S30P S30Q S30R S30T S30V S30Y L31A L31C L31D L31E L31H L31K L31M L31N L31P L31Q L31R L31S L31T L31W L31Y D32A D32C D32E D32F D32G D32H D32I D32K D32L D32M D32N D32P D32Q D32R D32S D32T D32V D32W D32Y A33C A33D A33E A33G A33H A33I A33K A33L A33M A33N A33P A33Q A33R A33S A33T A33V A33W A33Y P34A P34C P34D P34E P34F P34H P34I P34K P34L P34M P34N P34Q P34R P34S P34T P34V P34W P34Y L35A L35E L35G L35H L35I L35K L35M L35N L35P L35Q L35R L35S L35T L35V L35W L35Y T36A T36C T36E T36F T36G T36H T36I T36K T36L T36M T36N T36P T36Q T36R T36S T36V T36W T36Y S37A S37C S37D S37E S37F S37G S37H S37I S37K S37L S37M S37N S37P S37Q S37R S37T S37V S37W S37Y V38A V38C V38D V38E V38G V38H V38I V38L V38M V38N V38P V38Q V38R V38S V38T V38W V38Y R39A R39C R39D R39E R39F R39G R39H R39K R39L R39M R39N R39P R39Q R39S R39T R39V R39W R39Y V40A V40C V40E V40F V40G V40H V40I V40K V40L V40M V40P V40Q V40R V40S V40T V40W V40Y I41A I41C I41F I41G I41H I41K I41L I41M I41N I41P I41Q I41R I41S I41T I41V I41Y I42A I42C I42D I42F I42G I42H I42K I42L I42M I42N I42P I42Q I42R I42S I42T I42V I42Y T43A T43E T43F T43G T43H T43I T43K T43L T43N T43P T43Q T43R T43S T43W T43Y E44A E44C E44D E44G E44H E44I E44K E44L E44M E44N E44P E44Q E44R E44S E44T E44V E44Y M45A M45D M45E M45G M45H M45I M45L M45N M45P M45Q M45R M45S M45T M45V M45Y A46D A46E A46H A46I A46K A46L A46M A46N A46P A46Q A46R A46S A46T A46Y K47A K47C K47D K47E K47F K47G K47H K47I K47L K47M K47N K47P K47Q K47R K47S K47T K47Y G48A G48C G48E G48F G48H G48I G48K G48L G48M G48N G48P G48Q G48R G48S G48T G48V G48W G48Y H49A H49D H49E H49F H49K H49L H49M H49N H49P H49Q H49R H49S H49T H49V H49W H49Y F50A F50C F50D F50E F50G F50H F50I F50K F50L F50M F50N F50P F50Q F50R F50S F50T F50V F50W F50Y G51C G51E G51F G51H G51I G51K G51L G51M G51N G51P G51Q G51R G51S G51W G51Y I52A I52C I52D I52E I52F I52G I52K I52L I52M I52N I52P I52Q I52R I52S I52T I52V I52W G53A G53C G53E G53F G53H G53I G53K G53L G53M G53N G53P G53Q G53R G53S G53T G53V G53W G53Y G54A G54C G54D G54E G54F G54H G54I G54K G54L G54M G54N G54P G54Q G54S G54T G54V G54W G54Y E55A E55D E55I E55K E55L E55M E55N E55P E55Q E55R E55S E55T E55V E55W E55Y L56A L56C L56E L56F L56G L56H L56I L56K L56M L56N L56P L56Q L56R L56S L56T L56V L56W L56Y A57E A57F A57G A57H A57K A57L A57M A57N A57P A57Q A57R A57S A57T A57V A57W A57Y S58A S58C S58E S58F S58H S58K S58L S58M S58N S58P S58Q S58R S58T S58V S58W K59A K59E K59F K59G K59H K59I K59L K59M K59N K59P K59Q K59R K59S K59T K59V K59W K59Y V60A V60D V60E V60F V60H V60I V60K V60L V60M V60N V60P V60Q V60R V60S V60T V60Y R61A R61C R61D R61E R61F R61G R61H R61I R61K R61L R61M R61N R61P R61Q R61S R61T R61V R61Y R62A R62C R62D R62F R62G R62H R62I R62K R62L R62M R62N R62P R62Q R62S R62T R62V R62W R62Y

Visualization : Activity — Classical

Mutation Effect

Select a condition below. Conditions with >50 mutations show a heatmap, ranked lollipop, or ranked lollipop; others show paired bars per mutation.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*