Manganese peroxidase (gene MnP) from Bjerkandera adusta

Enzyme Description

Species

Extremophile

EC Number

1.11.1.13 ↗

Sequence

Length: 366 amino acids

MAFKQLAAALSIALALPFSQAAITRRVACPDGVNTATNAACCALFAVRDDIQQNLFDGGECGEEVHESLRLTFHDAIGISPSIAATGKFGGGGADGSIMIFDDIEPNFHANNGVDEIISAQKPFVAKHNMTAGDFIQFAGAVGVSNCPGAPQLSFFLGRPAATQPAPDGLVPEPFDSVTDILNRFADAGGFTTQEVVWLLASHSIAAADHVDPTIPGSPFDSTPEIFDTQFFVETLLKGTLFPGTSGNQGEVESPLAGEIRLQSDADFARDSRTACEWQSFVNNQPRMQVLFKAAMQKLSILGHDLTQMIDCSDVIPVPPSTAVRGSHLPAGNTLDDIEQACASTPFPTLTADPGPATSVAPVPPS

Shinichi Yoshida et al. (1998) — Reaction of manganese peroxidase of Bjerkandera adusta with synthetic lignin in acetone solution

Journal of Wood Science · doi:10.1007/BF00833415 ↗ · Activity - Classical

18 measurements ▼

Database ID

UniProt: Q3SC77 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Purified, fungus Bjerkandera adusta

Experimental Data (18 measurements)

18 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetonitrile	70%	100	77	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethylformamide (DMF)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	70%	100	1	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	70%	100	20	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	2-Methoxyethanol	70%	100	16	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethylene Glycol	70%	100	31	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	1,4-Dioxane	70%	100	23	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	70%	100	73	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetonitrile	70%	100	35	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethylformamide (DMF)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	2-Methoxyethanol	70%	100	11	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethylene Glycol	70%	100	17	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	1,4-Dioxane	70%	100	20	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	70%	100	26	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetonitrile	70%	100	77	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethylformamide (DMF)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	70%	100	1	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	70%	100	20	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	2-Methoxyethanol	70%	100	16	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethylene Glycol	70%	100	31	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	1,4-Dioxane	70%	100	23	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized 2,6-Dimethoxyphenol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	70%	100	73	%	50 mM lactate buffer	4.5	37°C	14 mM 2,6-Dimethoxyphenol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetonitrile	70%	100	35	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Dimethylformamide (DMF)	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Methanol	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethanol	70%	100	0	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	2-Methoxyethanol	70%	100	11	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Ethylene Glycol	70%	100	17	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	1,4-Dioxane	70%	100	20	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (oxidized guaiacol reaction products absorbance measurement, 465 nm) in the presence of organic solvent	Acetone	70%	100	26	%	50 mM lactate buffer	4.5	37°C	14 mM Guaiacol, 0.25 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized guaiacol	0.2 mM MnSO₄	—	Classical aqueous control (in %)

Visualization : Activity — Classical

Shinichi Yoshida et al. (1998)

One bar per measurement. Colour = solvent, shade = solvent volume.

K. Iwahara et al. (2000) — Polymerization of guaiacol by lignin-degrading manganese peroxidase from Bjerkandera adusta in aqueous organic solvents

Applied Microbiology and Biotechnology · doi:10.1007/s002530000340 ↗ · Activity + Stability - Product Formation

13 measurements ▼

Database ID

UniProt: Q3SC77 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Purified, fungus Bjerkandera adusta

Experimental Data (13 measurements)

13 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	1,4-Dioxane	50%	33.0	1.5	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Dimethylformamide (DMF)	50%	33.0	5.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Dimethyl Sulfoxide (DMSO)	50%	33.0	4.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Ethanol	50%	33.0	4.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetonitrile	50%	33.0	1.5	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Methanol	50%	33.0	1.5	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Ethylene Glycol	50%	33.0	2.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	2-Methoxyethanol	50%	33.0	2.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	10%	33.0	44.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	30%	33.0	64.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	50%	33.0	22.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	70%	33.0	2.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	90%	33.0	0.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O , Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)

Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	1,4-Dioxane	50%	33.0	1.5	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Dimethylformamide (DMF)	50%	33.0	5.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Dimethyl Sulfoxide (DMSO)	50%	33.0	4.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Ethanol	50%	33.0	4.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetonitrile	50%	33.0	1.5	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Methanol	50%	33.0	1.5	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Ethylene Glycol	50%	33.0	2.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	2-Methoxyethanol	50%	33.0	2.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	10%	33.0	44.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	30%	33.0	64.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	50%	33.0	22.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	70%	33.0	2.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)
Activity + Stability - Product Formation	Product polymerization yield after incubation (24 hours at room temperature) in the presence of organic solvent, measured by mass spectrometry (average molecular weight of the methanol-insoluble fraction)	Acetone	90%	33.0	0.0	%	50 mM lactate buffer, 5mM Mn2SO4	4.5	Room temperature	150 mM Guaiacol, 20 mM H₂O₂ (Hydrogen Peroxide)	H2O, Oxidized 2,6-Dimethoxyphenol	0.2 mM MnSO₄	—	Classical aqueous control (in %)

Visualization : Activity + Stability — Product Formation

K. Iwahara et al. (2000)

One bar per measurement. Colour = solvent, shade = solvent volume.

Yuxin Wang et al. (2002) — Purification, Characterization, and Chemical Modification of Manganese Peroxidase from Bjerkandera adusta UAMH 8258

Current Microbiology · doi:10.1007/s00284-001-0081-x ↗ · Activity - Classical

56 measurements ▼

Database ID

UniProt: Q3SC77 ↗

Sequence Annotation

Inferred - from protein name (first 43 residues from UniProt sequence absent from the mature protein)

Protein Source

Purified, fungus Bjerkandera adusta UAMH 8258

Experimental Data (56 measurements)

56 measurements — page 2 of 3

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	25%	100	60	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	30%	100	55	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	35%	100	50	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	40%	100	44	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	45%	100	37	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	50%	100	30	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	55%	100	15	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	60%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	30%	100	28	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	10%	100	85	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	15%	100	80	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	20%	100	50	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	25%	100	40	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	30%	100	20	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	40%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	50%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	60%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	5%	100	77	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	10%	100	65	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	15%	100	56	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3- , OH-	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	55%	100	13	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	50%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	55%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	60%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	5%	100	75	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	10%	100	60	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	15%	100	56	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	20%	100	51	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	25%	100	42	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	30%	100	39	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	35%	100	32	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	40%	100	27	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	45%	100	23	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	50%	100	12	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	45%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Ethanol	60%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	5%	100	88	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	10%	100	79	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	15%	100	71	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	20%	100	63	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	25%	100	60	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	30%	100	55	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	35%	100	50	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	40%	100	44	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	45%	100	37	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	50%	100	30	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	55%	100	15	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Methanol	60%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	30%	100	28	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	10%	100	85	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	15%	100	80	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	20%	100	50	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	25%	100	40	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	30%	100	20	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	40%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	50%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	60%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	5%	100	77	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	10%	100	65	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	15%	100	56	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	20%	100	48	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	25%	100	43	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Acetonitrile	5%	100	90	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	35%	100	16	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	40%	100	10	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	45%	100	3	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Dimethylformamide (DMF)	55%	100	0	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	5%	100	89	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	10%	100	60	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	15%	100	50	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	20%	100	39	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	25%	100	32	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	30%	100	26	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	35%	100	19	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, reaction product Mn3- and malonate complex absorbance measurement, 270 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	40%	100	10	%	50 mM malonate buffer	4.5	?	0.1 mM H₂O₂ (Hydrogen Peroxide), 1 mM Manganous sulfate	Mn3-, OH-	—	—	Classical aqueous control (in %)

‹ Prev

1 2 3

Next ›

Visualization : Activity — Classical

Yuxin Wang et al. (2002)

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Manganese peroxidase (gene MnP) from Bjerkandera adusta

Enzyme Description

Sequence

Experimental Data (18 measurements)

Visualization : Activity — Classical

Experimental Data (13 measurements)

Visualization : Activity + Stability — Product Formation

Experimental Data (56 measurements)

Visualization : Activity — Classical

Structure

Loading…