Manganese peroxidase (gene MnP2) from Trametes polyzona KU-RNW027

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 366 amino acids
MAFKTLASFVAVLAALQVANGALTRRVTCPDGVNTASNAACCALFPVLDDIQKNLFDGGQCGEEVHESLRLTFHDAIGISPKIAATGVFGGGGADGSIALFEDIETNFHANNGVDEIIDEQKPFIARHNITTADFIQFAGAIGVSNCPGAPRLDVFVGRKDATQPAPDKTVPEPFDSVDDILARFEDAGGFTAAEVVALLASGTRVAAADHVDPTIPGTPFDSTPERFDTQFFIETQLRGTLFPGTGGNQGEVESPLQGELRLQSDAELARDSRTACEWQSFVNNQAKMQSAFKAAFRKMTVLGHNVNDLVDCSEVVPTPPAPASNAHFPAGLSNKDVEQACSSTPFPTLPTDPGPVTSVAPVPPS
Piyangkun Lueangjaroenkit et al. (2019) β€” Two Manganese Peroxidases and a Laccase of Trametes polyzona KU-RNW027 with Novel Properties for Dye and Pharmaceutical Product Degradation in Redox Mediator-Free System
Mycobiology  Β· doi:10.1080/12298093.2019.1589900 β†—  Β· Stability - Incubation
30 measurements
Database ID
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, fungus Trametes polyzona KU-RNW027

Experimental Data (30 measurements)

30 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase 1-Propanol 10% 100.0 170.0 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Ethanol 50% 100.0 85.0 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Ethanol 40% 100.0 117.5 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Ethanol 30% 100.0 176.0 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Ethanol 20% 100.0 188.5 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Ethanol 10% 100.0 169.5 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Methanol 50% 100.0 81.5 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Methanol 40% 100.0 112.0 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Methanol 30% 100.0 153.0 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase Methanol 20% 100.0 176.5 % Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 1mM MnSOβ‚„ Incubation: ?, Assay: 4.5 Incubation: 4Β°C, Assay: 37Β°C 1 mM 2,6-Dimethoxyphenol 2,6-dimethoxyphenoxy radical β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*