Manganese peroxidase (gene MnP2) from Trametes polyzona KU-RNW027

Enzyme Description

Species

Extremophile

EC Number

1.11.1.13 ↗

Sequence

Length: 366 amino acids

MAFKTLASFVAVLAALQVANGALTRRVTCPDGVNTASNAACCALFPVLDDIQKNLFDGGQCGEEVHESLRLTFHDAIGISPKIAATGVFGGGGADGSIALFEDIETNFHANNGVDEIIDEQKPFIARHNITTADFIQFAGAIGVSNCPGAPRLDVFVGRKDATQPAPDKTVPEPFDSVDDILARFEDAGGFTAAEVVALLASGTRVAAADHVDPTIPGTPFDSTPERFDTQFFIETQLRGTLFPGTGGNQGEVESPLQGELRLQSDAELARDSRTACEWQSFVNNQAKMQSAFKAAFRKMTVLGHNVNDLVDCSEVVPTPPAPASNAHFPAGLSNKDVEQACSSTPFPTLPTDPGPVTSVAPVPPS

Piyangkun Lueangjaroenkit et al. (2019) — Two Manganese Peroxidases and a Laccase of Trametes polyzona KU-RNW027 with Novel Properties for Dye and Pharmaceutical Product Degradation in Redox Mediator-Free System

Mycobiology · doi:10.1080/12298093.2019.1589900 ↗ · Stability - Incubation

30 measurements ▼

Database ID

UniProt: A0A2Z5WAA7 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Purified, fungus Trametes polyzona KU-RNW027

Experimental Data (30 measurements)

30 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Propanol	10%	100.0	170.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	50%	100.0	85.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	40%	100.0	117.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	30%	100.0	176.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	20%	100.0	188.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	10%	100.0	169.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	50%	100.0	81.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	40%	100.0	112.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	30%	100.0	153.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	20%	100.0	176.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Isopropanol	10%	100.0	170.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Acetone	50%	100.0	74.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Acetone	40%	100.0	97.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Acetone	30%	100.0	120.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Acetone	20%	100.0	131.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Acetone	10%	100.0	171.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Butanol	50%	100.0	201.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Butanol	40%	100.0	206.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Butanol	30%	100.0	215.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Butanol	20%	100.0	226.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Butanol	10%	100.0	212.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Isopropanol	50%	100.0	39.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Isopropanol	40%	100.0	43.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Isopropanol	30%	100.0	57.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Isopropanol	20%	100.0	131.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	10%	100.0	161.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Propanol	50%	100.0	48.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Propanol	40%	100.0	49.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Propanol	30%	100.0	61.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Propanol	20%	100.0	104.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	1-Propanol	10%	100.0	170.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	50%	100.0	85.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	40%	100.0	117.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	30%	100.0	176.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	20%	100.0	188.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Ethanol	10%	100.0	169.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	50%	100.0	81.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	40%	100.0	112.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	30%	100.0	153.0	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 hour at 4°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase	Methanol	20%	100.0	176.5	%	Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM H₂O₂ (Hydrogen Peroxide), 1mM MnSO₄	Incubation: ?, Assay: 4.5	Incubation: 4°C, Assay: 37°C	1 mM 2,6-Dimethoxyphenol	2,6-dimethoxyphenoxy radical	—	—	Non-incubated control (in %), assay in aqueous phase \| High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*