Flavin-containing monooxygenase from Nitrincola lacisaponensis

Enzyme Description

Species

Nitrincola lacisaponensis ↗

Extremophile

Yes "alkaliphilic extremophilic" organism

EC Number

1.14.13.148 ↗

Sequence

Length: 454 amino acids

MNTRVAIIGAGPCGLAQLRAFQSAAAKGAAIPELVCFEKQSDWGGMWNYTWRTGVDEHGEPVHGSMYRYLWSNGPKECLEFADYTFDEHFGRPIGSYPPREVLWDYIKGRVEKAGVRDYIRFNTAVRQVSYDETSGLFSVTVQDHSNNRVYTETFDYVVNACGHFSTPNTPYFEGFERFGGRVLHAHDFRDALEFKDKDILVVGSSYSAEDIGSQCYKYGARSITSCYRSAPMGYQWPQNWEEKPLLQRVDSDTAWFADGSHKRIDAIILCTGYQHHFPFLPDSLRLITENRLWPLKLYKGIFWEDNPKFLYLGMQDQWYSFNMFDAQAWYARDVILGRISLPGKAEMQAENQAWREREEKLQTAQEMFEFQGSYIQHLIDATDYPSFDIQAVNETFLAWKHDKYEDIMGYRNKCYRSLMTGTLATPHHTPWLDALDDSLEAYLQETPRLKSAV

Nikola Lončar et al. (2019) — Characterization of a thermostable flavin-containing monooxygenase from Nitrincola lacisaponensis (NiFMO)

Applied Microbiology and Biotechnology · doi:10.1007/s00253-018-09579-w ↗ · Activity - Classical Stability - Tm

32 measurements ▼

Database ID

UniProt: A0A063Y6V3 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli NEB10β

Experimental Data (32 measurements)

32 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	51.0	46.3	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	7.5%	51.0	45.8	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	51.0	46.6	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2.5%	51.0	46.5	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	10%	51.0	44.0	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	7.5%	51.0	44.9	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	5%	51.0	45.6	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	2.5%	51.0	46.6	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	10%	51.0	42.1	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	7.5%	51.0	44.1	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	5%	51.0	45.5	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	2.5%	51.0	46.9	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)

Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	1.05	0.5	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	2.5%	1.05	0.3	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	10%	1.05	0.6	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	7.5%	1.05	0.7	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	5%	1.05	0.8	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Acetonitrile	2.5%	1.05	0.8	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	1.05	0.1	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	7.5%	1.05	0.2	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	1.05	0.2	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2.5%	1.05	0.3	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	1.05	0.7	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	7.5%	1.05	0.8	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	1.05	0.9	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	2.5%	1.05	0.8	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	1.05	0.4	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Activity - Classical	Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	7.5%	1.05	0.5	1/s	50 mM potassium phosphate buffer	7.5	25°C	Molecular oxygen, Trimethylamine	H2O, Trimethylamine N-oxide	—	—	Classical aqueous control (in 1/s)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Acetonitrile	10%	51.0	39.3	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Acetonitrile	7.5%	51.0	41.3	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Acetonitrile	5%	51.0	44.5	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Acetonitrile	2.5%	51.0	45.5	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	51.0	46.3	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	7.5%	51.0	45.8	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	51.0	46.6	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2.5%	51.0	46.5	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	10%	51.0	44.0	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	7.5%	51.0	44.9	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	5%	51.0	45.6	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Methanol	2.5%	51.0	46.6	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	10%	51.0	42.1	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	7.5%	51.0	44.1	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	5%	51.0	45.5	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent	Ethanol	2.5%	51.0	46.9	°C	50 mM potassium phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C)

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*