NAD(P) dependent formate dehydrogenase (gene fdh) from Burkholderia dolosa PC543
Enzyme Description
Species
Extremophile
No
but organic "solvent-tolerant" and "acidic-tolerant" enzyme
EC Number
Sequence
MATVLCVLYPDPVDGYPPHYVRDTIPVITRYADGQTAPTPAGPPGFRPGELVGSVSGALGLRGYLEAHGHTLIVTSDKDGPDSEFERRLPDADVVISQPFWPAYLTAERIARAPKLRLALTAGIGSDHVDLDAAARAHITVAEVTGSNSISVAEHVVMTTLALVRNYLPSHAIAQQGGWNIADCVSRSYDVEGMHFGTVGAGRIGLAVLRRLKPFGLHLHYTQRHRLDAAIEQELGLTYHADPASLAAAVDIVNLQIPLYPSTEHLFDAAMIARMKRGAYLINTARAKLVDRDAVVRAVTSGHLAGYGGDVWFPQPAPADHPWRAMPFNGMTPHISGTSLSAQARYAAGTLEILQCWFDGRPIRNEYLIVDGGTLAGTGAQSYRLT
Saadet AlpdaΔtaΕ et al. (2018)
β DMSO tolerant NAD(P)H recycler enzyme from a pathogenic bacterium, Burkholderia dolosa PC543: effect of N-/C-terminal His Tag extension on protein solubility and activity
Engineering in Life Sciences
Β· doi:10.1002/elsc.201800036 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI00017992AD β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (30 measurements)
30 measurements β page 2 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 20% | 100 | 86 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 142 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 10% | 100 | 107 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 10% | 100 | 80 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 10% | 100 | 129 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 10% | 100 | 117 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100 | 132 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 5% | 100 | 116 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Acetonitrile | 5% | 100 | 101 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 5% | 100 | 126 | % | 64 mM sodium phosphate buffer | 6.2 | 37Β°C | 170 mM Sodium formate | CO2 , H+ | 1 mM NADP+ | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.