C-terminal truncated lipase from Staphylococcus epidermis AT2

Enzyme Description

Species

Extremophile

EC Number

3.1.1.3 ↗

Sequence

Length: 395 amino acids

INQLTAQAQYKNQYPVVFVHGFVGLVGEDSFSMYPNYWGGTKYNVKQELTKLGYRVHEANVGAFSSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKKIHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMVSTITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQWGFKQKPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPNIVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRAIGGDDNKNVRVNDGIVPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTDYKRTGEELGQFYMSMINNMLKVEELDGITRK

Jiivittha Veno et al. (2017) — Directed Evolution of Recombinant C-Terminal Truncated Staphylococcus epidermidis Lipase AT2 for the Enhancement of Thermostability

International Journal of Molecular Sciences · doi:10.3390/ijms18112202 ↗ · Stability - Incubation

32 measurements ▼

Database ID

UniProt: B5A5A8 ↗

Sequence Annotation

Inferred - from protein name (248 first residues from UniProt sequence absent from the mature protein)

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (32 measurements)

32 measurements — page 2 of 2

Mutation	Property	Assay	Solvent	Solvent Volume	Aqueous Reference	WT Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Octanol	50%	100	0	37	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	50%	100	0	53	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Benzene	50%	100	0	74	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Chloroform	50%	100	48	48	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Diethyl Ether	50%	100	225	418	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	50%	100	137	322	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Propanol	50%	100	0	60	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	50%	100	26	145	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	50%	100	12	106	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	50%	100	0	47	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	50%	100	110	266	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	181	297	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Propanol	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Octanol	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Benzene	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Chloroform	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	p-Xylene	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Diethyl Ether	50%	100	—	225	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	50%	100	—	137	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	50%	100	—	26	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Heptane	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	50%	100	—	12	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexadecane	50%	100	—	0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	50%	100	—	110	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
WT	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	—	181	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 25°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	50%	100	0	59	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexadecane	50%	100	0	23	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	p-Xylene	50%	100	0	55	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Heptane	50%	100	0	33	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Octanol	50%	100	0	37	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	50%	100	0	53	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Benzene	50%	100	0	74	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Chloroform	50%	100	48	48	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Diethyl Ether	50%	100	225	418	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Isopropanol	50%	100	137	322	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Propanol	50%	100	0	60	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	50%	100	26	145	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	50%	100	12	106	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	50%	100	0	47	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Methanol	50%	100	110	266	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C	Stability - Incubation	Activity after incubation (30 minutes at 50°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	181	297	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic	Incubation: ?, Assay: 8	Incubation: 50°C, Assay: 45°C	0.6 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

‹ Prev

1 2

Next ›

Mutations in this dataset (2)

WT G210C

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*