Vimelysin from Vibrio sp. T-1800

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 412 amino acids
AKSSGTGPGGNLKTTRYEYGSDFPSFSIDKTGTTCKLENDSVKTVNLNHGTSGSAAYSYNCADGTNYTDHKYINGAYSPLNDAHYFGNVVFDMYKEWMNTSPLTFQLTMRVHYSSNYENAFWNGSSMTFGDGGSTFYPLVDINVSAHEVSHGFTEQNSGLVYQNMSGGINEAFSDIAGEAAEYYLRGNVDWVVGSDIFKSEGGLRYFDQPSKDGRSIDHASQYYDGLNVHLSSGVYNRAFYLLANKSGWDVRKGFEIFTVANQLYWTANSTFDAGACGVAKAAADMGYVVADVEDAFNTVGVNGSCGSTPPTGNVLTKGTPIANLSGNQSSESFYTFTVDSASSATVSMSGGSGDADLYVKSGSKPTTSSYDCRPYRAGNNEQCSVSAQPGITYHVLLRGYSNYSGLTLRLD
Kohei Oda et al. (1996) β€” A Novel Alcohol Resistant Metalloproteinase, Vimelysin, from Vibrio sp. T1800: Purification and Characterization
Bioscience, Biotechnology, and Biochemistry  Β· doi:10.1271/bbb.60.463 β†—  Β· Activity - Classical
22 measurements
Database ID
UniProt: Q76LC2 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Vibrio sp. T-1800

Experimental Data (22 measurements)

22 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 10% 100 14 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethylformamide (DMF) 30% 100 1 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 100 10 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethylformamide (DMF) 10% 100 26 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethylformamide (DMF) 5% 100 39 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100 28 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100 46 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 70 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100 88 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 30% 100 1 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 20% 100 4 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Methanol 10% 100 61 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 5% 100 25 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 30% 100 2 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 20% 100 16 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 10% 100 21 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Isopropanol 5% 100 35 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Ethanol 30% 100 11 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Ethanol 20% 100 18 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (FAGLA absorbance measurement, 345 nm) in the presence of organic solvent Ethanol 10% 100 42 % 0.1 M MES 6.5 ? 1 mM FAGLA (FA-Gly-DL-Leu-NH2) Furylacryloyl-Gly , Leu-NH2 β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2

Visualization : Activity β€” Classical

Kohei Oda et al. (1996)

One bar per measurement. Colour = solvent, shade = solvent volume.

Toshihiro Takahashi et al. (2005) β€” Molecular Cloning of the Gene Encoding Vibrio Metalloproteinase Vimelysin and Isolation of a Mutant with High Stability in Organic Solvents
The Journal of Biochemistry  Β· doi:10.1093/jb/mvi173 β†—  Β· Stability - Incubation
8 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*