Sortase A (gene SrtA) from Staphylococcus aureus

Enzyme Description

Species

Extremophile

EC Number

3.4.22.70 ↗

Sequence

Length: 206 amino acids

MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

Zhimeng Wu et al. (2017) — Efficient expression of sortase A from Staphylococcus aureus in Escherichia coli and its enzymatic characterizations

Bioresources and Bioprocessing · doi:10.1186/s40643-017-0143-y ↗ · Activity - Classical

25 measurements ▼

Database ID

UniProt: Q2FV99 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (25 measurements)

25 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Ethanol	10%	100	58	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET , GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	50%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET , GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	40%	100	4	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET , GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	30%	100	18	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET , GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	20%	100	61	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET , GEE-Edans	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetonitrile	30%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100	10	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100	70	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	96	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	98	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	98	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetone	50%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetone	40%	100	2	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetone	30%	100	25	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetone	20%	100	50	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetone	10%	100	74	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetonitrile	50%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetonitrile	40%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	10%	100	73	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetonitrile	20%	100	26	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Acetonitrile	10%	100	68	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Ethanol	50%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Ethanol	40%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Ethanol	30%	100	1	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Ethanol	20%	100	17	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Ethanol	10%	100	58	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	50%	100	0	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	40%	100	4	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	30%	100	18	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent	Methanol	20%	100	61	%	50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2	7.8	37°C	0.5 Mg Dabcyl-QALPETGEE-Edans	Dabcyl-QALPET, GEE-Edans	—	—	Classical aqueous control (in %)

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*