Esterase from Shewanella sp.

Enzyme Description

Species

Shewanella sp. ↗

Extremophile

No but "cold-adapted", "halotolerant" enzyme

EC Number

3.1.1.1 ↗

Sequence

Length: 223 amino acids

MSSATLDAVVVEPREPATACVIWLHGLGDSGDGFAPVVPALGLPADHSIRFVFPHAPEQAVTVNGGYVMRAWYDIKSLNLHDRADMPGVLQSERLVRQLIEQQVAQGIAANRIVLAGFSQGGVMSLFTALRYPEALAGIMALSCYLPGGEQLPEDVSSANRDTPILQCHGEQDDVVALSAGLMAKEALEQGGYRLEWHTFPMAHGVVPQELNLISQWLQARLS

Yian Hang et al. (2016) — Mutational analysis and stability characterization of a novel esterase of lipolytic enzyme family VI from Shewanella sp

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2016.09.032 ↗ · Activity - Classical

24 measurements ▼

Database ID

UniProt: A0A380BYZ7 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (24 measurements)

24 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	20%	100.0	1.88	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	10%	100.0	11.04	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	30%	100.0	2.55	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	20%	100.0	18.24	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	113.49	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	30%	100.0	0.0	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	20%	100.0	0.0	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	10%	100.0	65.0	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Isopropanol	30%	100.0	3.41	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Isopropanol	20%	100.0	30.48	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Isopropanol	10%	100.0	89.63	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethylene Glycol	30%	100.0	125.06	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethylene Glycol	20%	100.0	94.01	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethylene Glycol	10%	100.0	92.48	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	50.02	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	75.15	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	10%	100.0	55.52	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	30%	100.0	19.94	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	20%	100.0	107.09	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	10%	100.0	95.35	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Methanol	30%	100.0	74.11	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Methanol	20%	100.0	111.01	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Methanol	10%	100.0	101.16	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	30%	100.0	0.91	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	20%	100.0	1.88	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	10%	100.0	11.04	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	30%	100.0	2.55	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	20%	100.0	18.24	%	50 mM phosphate-citrate buffer	8	30°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*