Esterase (gene Est-AF) from Archaeoglobus fulgidus

Enzyme Description

Species

Archaeoglobus fulgidus ↗

Extremophile

Yes hyperthermophilic organism

EC Number

3.1.1.1 ↗

Sequence

Length: 247 amino acids

MERITLEIDALKISVLKGKEKDVMYIHGSGCDATLWERQLEDVGGYAIDLPNHGRSCAAEIRDIGDYAYFVAKTVKKLMGKAVIVGHSLGGAVAQKIYLEYPKVVKALVLVGTGARLRVMPEILTMLKEKPAEAAELVSKYAFSNQELAKEFSKVFAERAGVLHLDLSLCDRFDLLEDYRSGKVKVDIPTLLIVGEKDALTPVKYSEFFKKHIPSAEMVVIPEAGHMVMLEKPDEFNRALKNFIEKL

Jinyeong Kim et al. (2015) — Improved enantioselectivity of thermostable esterase from Archaeoglobus fulgidus toward (S)-ketoprofen ethyl ester by directed evolution and characterization of mutant esterases

Applied Microbiology and Biotechnology · doi:10.1007/s00253-015-6422-7 ↗ · Activity - Classical Specificity - Enantioselectivity

120 measurements ▼

Database ID

UniProt: O27948 ↗

Sequence Annotation

Inferred

Protein Source

Recombinant, host bacterium Escherichia coli XL1-blue

Experimental Data (120 measurements)

120 measurements — page 1 of 6

Mutation	Property	Assay	Solvent	Solvent Volume	Aqueous Reference	WT Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	10%	100.0	—	26.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	20%	100.0	—	4.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	10%	100.0	—	16.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	20%	100.0	—	1.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	100.0	—	43.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	100.0	—	13.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	—	64.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	—	32.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	10%	100.0	—	120.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	20%	100.0	—	108.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	10%	100.0	—	1.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	10%	100.0	—	3.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	10%	100.0	—	17.9	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	20%	100.0	—	3.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	10%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	10%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol , R-ketoprofen , S-ketoprofen	—	—	Classical aqueous control (in %)

WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	10%	100.0	—	26.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	20%	100.0	—	4.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	10%	100.0	—	16.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	20%	100.0	—	1.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	100.0	—	43.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	100.0	—	13.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	—	64.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	—	32.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	10%	100.0	—	120.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	20%	100.0	—	108.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	10%	100.0	—	1.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	10%	100.0	—	3.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	10%	100.0	—	17.9	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	20%	100.0	—	3.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	10%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	10%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	20%	100.0	—	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetone	10%	-16.2	—	-33.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetone	20%	-16.2	—	-47.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetonitrile	10%	-16.2	—	-40.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetonitrile	20%	-16.2	—	-58.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	-16.2	—	-32.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	-16.2	—	-45.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	-16.2	—	-32.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	-16.2	—	-39.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	n-Hexane	10%	-16.2	—	-17.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	n-Hexane	20%	-16.2	—	-20.9	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Isopropanol	10%	-16.2	—	-49.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Isopropanol	20%	-16.2	—	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Ethanol	10%	-16.2	—	-48.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Ethanol	20%	-16.2	—	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Methanol	10%	-16.2	—	-41.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Methanol	20%	-16.2	—	54.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Butanol	10%	-16.2	—	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Butanol	20%	-16.2	—	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Propanol	10%	-16.2	—	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
WT	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Propanol	20%	-16.2	—	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	10%	100.0	26.4	67.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	20%	100.0	4.6	20.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	10%	100.0	16.2	75.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	20%	100.0	1.6	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	100.0	43.5	89.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	100.0	13.6	45.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	64.8	119.9	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	32.7	88.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	10%	100.0	120.1	120.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	20%	100.0	108.3	143.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	10%	100.0	1.7	13.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	10%	100.0	3.4	18.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	20%	100.0	0.0	2.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	10%	100.0	17.9	58.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	20%	100.0	3.6	18.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	10%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	10%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	10%	100.0	26.4	61.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetone	20%	100.0	4.6	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	10%	100.0	16.2	23.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Acetonitrile	20%	100.0	1.6	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	100.0	43.5	59.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	100.0	13.6	1.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	64.8	31.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	32.7	12.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	10%	100.0	120.1	120.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	n-Hexane	20%	100.0	108.3	86.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	10%	100.0	1.7	3.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Isopropanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	10%	100.0	3.4	28.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Ethanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	10%	100.0	17.9	61.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	Methanol	20%	100.0	3.6	6.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	10%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Butanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	10%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Activity - Classical	Activity measured by HPLC in the presence of organic solvent	1-Propanol	20%	100.0	0.0	0.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetone	10%	35.9	-33.8	61.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetone	20%	35.9	-47.7	63.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetonitrile	10%	35.9	-40.0	63.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetonitrile	20%	35.9	-58.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	35.9	-32.3	59.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	35.9	-45.4	69.4	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	35.9	-32.7	62.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	35.9	-39.1	73.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	n-Hexane	10%	35.9	-17.8	36.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	n-Hexane	20%	35.9	-20.9	56.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Isopropanol	10%	35.9	-49.3	54.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Isopropanol	20%	35.9	35.9	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Ethanol	10%	35.9	-48.8	42.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Ethanol	20%	35.9	35.9	31.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Methanol	10%	35.9	-41.3	52.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Methanol	20%	35.9	54.4	59.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Butanol	10%	35.9	35.9	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Butanol	20%	35.9	35.9	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Propanol	10%	35.9	35.9	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
V138G	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Propanol	20%	35.9	35.9	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetone	10%	89.2	-33.8	89.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetone	20%	89.2	-47.7	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetonitrile	10%	89.2	-40.0	90.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Acetonitrile	20%	89.2	-58.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	10%	89.2	-32.3	90.2	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethylformamide (DMF)	20%	89.2	-45.4	76.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	89.2	-32.7	89.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	89.2	-39.1	84.6	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	n-Hexane	10%	89.2	-17.8	88.7	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	n-Hexane	20%	89.2	-20.9	92.5	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Isopropanol	10%	89.2	-49.3	80.1	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Isopropanol	20%	89.2	89.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Ethanol	10%	89.2	-48.8	90.0	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Ethanol	20%	89.2	89.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Methanol	10%	89.2	-41.3	89.3	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	Methanol	20%	89.2	54.4	93.8	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Butanol	10%	89.2	89.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Butanol	20%	89.2	89.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Propanol	10%	89.2	89.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)
L200R	Specificity - Enantioselectivity	Enantiomeric excess of products (100*[S-ketoprofen]-[R-ketoprofen]/([S-ketoprofen]+[R-ketoprofen])), measured by HPLC in the presence of organic solvent	1-Propanol	20%	89.2	89.2	—	%	50 mM Tris-HCl buffer, 0.1% Triton X-100	8	70°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	Ethanol, R-ketoprofen, S-ketoprofen	—	—	Classical aqueous control (in %)

‹ Prev

1 2 3 4 … 6

Next ›

Mutations in this dataset (3)

WT V138G L200R

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Specificity — Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Esterase (gene Est-AF) from Archaeoglobus fulgidus

Enzyme Description

Sequence

Experimental Data (120 measurements)

Visualization : Activity — Classical

Mutation Effect

Visualization : Specificity — Enantioselectivity

Mutation Effect

Structure

Loading…