Phospholipase B from Thermotoga lettingae TMO

Enzyme Description

Species
Thermotoga lettingae TMO β†—
Extremophile
Yes "thermophilic" organism
EC Number
3.1.1.5 β†—

Sequence

Length: 250 amino acids
MRLKKIDGKKGYVVLVHGLGEHCGRYTWLIDLLRSEDYGLIMFDLPGHGENSGKKGHATFREIFEILDGIFHSEPDSFLMGHSLGGLIAIRYAELRNNVRGLIVTSPALKISNDNFFLRLLATLVSVISPKTTFNNGIDPYNLSPNIEAVKRYINDPLVHEKISAKLAFDMLVNSKRALREAFKIKIPCFIGVGEKDKITLPEGAYLFFNRVSSEDKTLKTYHGGYHELFEDPANMSLFLSDFVDWLRRH
Tao Wei et al. (2015) β€” Characterization of a novel thermophilic phospholipase B from Thermotoga lettingae TMO: applicability in enzymatic degumming of vegetable oils
Journal of Industrial Microbiology and Biotechnology  Β· doi:10.1007/s10295-014-1580-7 β†—  Β· Stability - Incubation
60 measurements ▼
Database ID
UniParc: UPI00015CEAF9 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (60 measurements)

60 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Benzene 20% 100 129 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Benzene 50% 100 121 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Toluene 20% 100 127 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Toluene 50% 100 135 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Xylene 20% 100 145 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Xylene 50% 100 161 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase n-Hexane 20% 100 95 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase n-Hexane 50% 100 91 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase n-Heptane 20% 100 106 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (160 hours at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase n-Heptane 50% 100 109 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Xylene 50% 100 105 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Ethanol 50% 100 99 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Acetone 20% 100 113 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Acetone 50% 100 95 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Methanol 20% 100 96 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Methanol 50% 100 91 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Dimethylformamide (DMF) 20% 100 108 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Dimethylformamide (DMF) 50% 100 94 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Dimethyl Sulfoxide (DMSO) 20% 100 108 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by pH-stat (free fatty acids titration assay) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 94 % 50 mM sodium acetate buffer incubation, 50 mM (including emulsion in volume) sodium acetate buffer incubation Incubation: 5.5, Assay: 5.5 Incubation: Room temperature, Assay: 70Β°C 4% polyvinyl alcohol), Phospholipid POPC (emulsion composed of 25% POPC free fatty acids , lyso-PC β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
β€Ή Prev
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*