Fumarate hydratase class II from Thermus thermophilus HB8

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 466 amino acids
MEYRIERDTMGEVRVPADKYWGAQTQRSLENFRIGTDRFRMPLEIIRAYGMLKKAAARANLELGELPEEIAKAIIQAAEEVVQGKWDDHFPLVVFQTGSGTQTNMNVNEVIANRASEILGKPLGSKYVHPNDHVNRGQSSNDTFPTAMYVAVALALHQRLYPAVEGLIRTFTAKAQAFDQIVKVGRTHLMDAVPITLGQEIGSWAAQLKTTLAAVKEMEKGLYNLAIGGTAVGTGLNAHPRFGELVAKYLAEETGLPFRVAENRFAALAAHDELVNVMGAIRTLAGALMKIGNDVRWLASGPYAGIGEITIPANEPGSSIMPGKVNPTQVEALTMVVVRVYGNDHTVAFAGSQGNFQLNVYKPVMAYSTLESINLLADAVASFDAHLAQGIEPNLERIEEHLQKNPMLATALNKAIGYDKAAEIVKKALKEKKTLKQAALELGYLTEEEFDRIVVPMRLAKPHEGA
Yanhui Liu et al. (2015) β€” Production of Fumaric Acid from l-Malic Acid by Solvent Engineering Using a Recombinant Thermostable Fumarase from Thermus thermophilus HB8
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-014-1468-z β†—  Β· Stability - Incubation Activity + Stability - Conversion
64 measurements
Database ID
UniProt: Q5SKT5 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (64 measurements)

64 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Conversion Conversion after incubation (360 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 70% 24.0 45.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (10 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 90% 15.9 3.7 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 90% 17.1 3.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (60 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 90% 17.3 2.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (120 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 90% 19.1 1.1 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (240 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 90% 23.3 0.2 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (360 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 90% 24.0 1.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (60 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Methanol 70% 17.3 1.8 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (10 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Methanol 30% 15.9 21.8 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (60 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Methanol 30% 17.3 23.8 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (120 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Methanol 30% 19.1 27.6 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (240 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Methanol 30% 23.3 35.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (360 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Methanol 30% 24.0 35.0 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (10 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent tert-Butanol 30% 15.9 3.0 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent tert-Butanol 30% 17.1 3.0 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (60 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent tert-Butanol 30% 17.3 4.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (120 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent tert-Butanol 30% 19.1 7.5 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (240 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent tert-Butanol 30% 23.3 2.9 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (360 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent tert-Butanol 30% 24.0 3.1 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (10 minutes at 70Β°C), measured by absorbance spectrophotometry (fumaric acid absorbance measurment, 250 nm) in the presence of organic solvent Ethylene Glycol 30% 15.9 17.8 % 100 mM Tris– HCl buffer 7.8 70Β°C 100 mM L-Malic acid Fumarate β€” β€” Classical aqueous control (in %)
1 2 3 4

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*