Azoreductase (gene GtAZR) from Geobacillus thermoglucosidasius C56-Y593
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MFMSIAVTGATGQLGGLVIQHLLKKVPASQIIAIARNVEKASALADQGVEVRHGDYDDPKSLEKAFAGASKLLFISSPDTDNTLRVVQHANVVKAARDAGVKHIAYTGYAFAEEATLPLAHVHLATEYAIRTTNIPYTFLRNALYTELFINEGLRASVESGAVVTNTGNGRINSVTRNDLALAAVTVLTEEGHENKTYNLVSNQPWNFDDLAQILSEVSGKKVVHQSVSFEEEKNILVNAGVPEPFAELTAAIYDAVSKGETSKTSDDLQKLIGSLTPLKETVKQALQI
Fen Gao et al. (2014)
β Molecular characterization of a novel thermal stable reductase capable of decoloration of both azo and triphenylmethane dyes
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-014-5896-z β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A024K767 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (40 measurements)
40 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 70% | 100 | 84 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Ethanol | 60% | 100 | 21 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Ethanol | 70% | 100 | 20 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Ethanol | 80% | 100 | 18 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 10% | 100 | 112 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 20% | 100 | 106 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 30% | 100 | 106 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 40% | 100 | 100 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 50% | 100 | 82 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 60% | 100 | 74 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Ethanol | 50% | 100 | 71 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetone | 80% | 100 | 88 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 10% | 100 | 105 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 20% | 100 | 109 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 30% | 100 | 116 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 40% | 100 | 88 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 50% | 100 | 88 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 60% | 100 | 80 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 70% | 100 | 56 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 80% | 100 | 57 | % | Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 25Β°C, Assay: 25Β°C | 0.1 mM Methyl red | Reduced amine products from Methyl red | 0.2 mM NADH | β | Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.