Pancreas elastase from Sus scrofa (pig)

Enzyme Description

Species
Sus scrofa (pig) β†—
Extremophile
No
EC Number
3.4.21.36 β†—

Sequence

Length: 240 amino acids
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Bassem Jaouadi et al. (2013) β€” Biochemical and molecular characterization of Pseudomonas aeruginosa CTM50182 organic solvent-stable elastase
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2013.05.019 β†—  Β· Stability - Incubation
40 measurements ▼
Database ID
UniProt: P00772 β†—
Sequence Annotation
Inferred - from protein name (26 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased

Experimental Data (40 measurements)

40 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase 1-Hexanol 60% 100 75 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Decane 60% 100 85 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Isooctane 60% 100 102 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Octane 60% 100 110 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Heptane 60% 100 115 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Hexane 60% 100 101 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Cyclohexane 60% 100 99 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Toluene 60% 100 93 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Benzene 60% 100 91 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Chloroform 60% 100 112 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Hexadecane 60% 100 81 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase 1-Butanol 60% 100 50 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Ethyl Acetate 60% 100 0 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Isopropanol 60% 100 111 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Isopropanol 60% 100 110 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Acetonitrile 60% 100 0 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Ethanol 60% 100 62 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Methanol 60% 100 71 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Dimethylformamide (DMF) 60% 100 121 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 60% 100 150 % Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*