Haloalkane dehalogenase linB from Sphingobium japonicum

Enzyme Description

Species

Extremophile

EC Number

3.8.1.5 ↗

Sequence

Length: 296 amino acids

MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA

Veronika Stepankova et al. (2013) — Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases

Biotechnology Journal · doi:10.1002/biot.201200378 ↗ · Activity - Classical Stability - C50 Stability - Tm

136 measurements ▼

Database ID

UniProt: D4Z2G1 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host bacterium Escherichia coli BL21

Experimental Data (136 measurements)

136 measurements — page 3 of 7

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	20%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	20%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	30%	100	90	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	30%	100	118	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	30%	100	100	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	30%	100	62	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	68	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	30%	100	11	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	40%	100	68	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	40%	100	122	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	40%	100	102	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol , Iodide ion	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	5%	100	91	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	5%	100	88	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	5%	100	92	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	5%	100	101	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	5%	100	85	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	5%	100	81	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	86	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	5%	100	93	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	5%	100	41	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	5%	100	71	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	5%	100	93	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	5%	100	110	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	5%	100	85	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	5%	100	64	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	10%	100	90	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	10%	100	80	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	10%	100	101	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	10%	100	104	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	10%	100	80	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	10%	100	78	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	87	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	10%	100	92	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	10%	100	31	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	10%	100	38	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	10%	100	86	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	10%	100	93	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	10%	100	54	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	10%	100	4	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	20%	100	95	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	20%	100	36	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	20%	100	109	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	20%	100	100	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	20%	100	83	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	20%	100	37	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	85	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	20%	100	76	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	20%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	20%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	20%	100	42	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	20%	100	5	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	20%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	20%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	30%	100	90	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	30%	100	118	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	30%	100	100	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	30%	100	62	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	68	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	30%	100	11	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	30%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	40%	100	68	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	40%	100	122	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	40%	100	102	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	40%	100	61	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100	63	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	40%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	50%	100	68	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	50%	100	119	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	50%	100	101	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100	47	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	50%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	60%	100	67	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	60%	100	86	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	60%	100	98	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	60%	100	7	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	60%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	75%	100	73	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	75%	100	3	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	75%	100	85	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	75%	100	0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	—	—	75	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	—	—	17	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	—	—	66	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	49	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	—	—	18	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	—	—	24	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	—	—	8	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	—	—	19	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	—	—	1	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	—	—	16	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	—	—	12	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	—	—	6	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Ethylene Glycol	20%	49	49	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by DSC in the presence of organic solvent	Dimethylformamide (DMF)	20%	49	38	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C) measured by DSC
Stability - Tm	Tm measured by DSC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	49	49	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C) measured by DSC
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Methanol	20%	49	43	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	1,4-Dioxane	20%	49	36	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetonitrile	10%	49	39	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetonitrile	20%	49	<10	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Ethanol	20%	49	39	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetone	20%	49	36	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Isopropanol	20%	49	37	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Tetrahydrofuran (THF)	10%	49	34	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Tetrahydrofuran (THF)	20%	49	<10	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), measured by circular dichroism

‹ Prev

1 2 3 4 … 7

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — C₅₀

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*