Ene-reductase Chr-OYE1 from Chryseobacterium sp. CA49

Enzyme Description

Species

Extremophile

EC Number

1.6.99.1 ↗

Sequence

Length: 353 amino acids

MSTESLFTPFKYKNLELKNRIVMAPMTRAQSDNGVPTQQIADYYARRAAAEVGLILSEGTVINRPASKNMQNIPDFYGTEALNGWKNVIDAVHHNGGKMGPQIWHVGDTRSTPDYPLEDMEKASTMTLEDIQDTIAQFAASAKSAKDLGFDVLEIHGAHGYLIDQFFWEGTNTRTDEYGGKTIKERSRFAVDVVKAIRAAVGEDFTIIIRLSQWKQQDYSVKLAHTPEEMEEWLLPLKDAGVDIFHCSQRRFWEPEFEGSDLNFAGWAKKITGQPTITVGSVGLEGDFMAAFGGQGTEKADLTELTKRLERGDFDLVAVGRALLQDPEWAKKVKEQNTEALLDFSAESLGVLY

Frieda A. Sorgenfrei et al. (2024) — Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification

Nature Communications · doi:10.1038/s41467-024-49774-0 ↗ · Activity - Classical Stability - C50 Stability - Tm

159 measurements ▼

Database ID

UniProt: A0A0U2H4S5 ↗

Sequence Annotation

Explicit - Provided UniProt Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (159 measurements)

159 measurements — page 3 of 8

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	143.9	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	139.4	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	109.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	62.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	56.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	19.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	16.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	4.5	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	128.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	129.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	105.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	56.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	19.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	7.0	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	8.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	7.0	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	5.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	111.4	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	80.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	48.6	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening

Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	115.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	119.4	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	117.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	108.7	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	92.2	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	69.9	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	109.4	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	116.0	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	124.5	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	114.2	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	89.6	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	59.4	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	101.8	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	98.2	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	102.7	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	99.1	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	82.9	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	40.5	%	50 mM sodium phosphate	7.4	25°C	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	5%	100.0	109.6	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	10%	100.0	118.4	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	15%	100.0	110.5	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	20%	100.0	97.4	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	25%	100.0	83.3	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Isopropanol	30%	100.0	72.8	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	5%	100.0	118.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	10%	100.0	110.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	15%	100.0	97.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	20%	100.0	66.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	25%	100.0	52.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	1-Propanol	30%	100.0	41.0	%	50 mM sodium phosphate	7.4	Room temperature	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	114.6	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	120.8	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	106.3	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	93.8	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	58.3	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	33.3	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	29.2	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	22.9	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	8.3	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	122.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	143.9	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	139.4	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	109.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	62.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	56.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	19.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	16.7	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	4.5	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	128.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	129.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	105.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	56.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	19.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	7.0	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	8.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	7.0	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	5.3	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	111.4	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	80.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	48.6	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	22.9	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	20.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	11.4	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	14.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	14.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	5.7	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	5%	100.0	110.4	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	10%	100.0	97.9	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	15%	100.0	41.7	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	20%	100.0	14.6	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	25%	100.0	10.4	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	30%	100.0	4.2	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	35%	100.0	8.3	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	40%	100.0	8.3	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Ethanol	45%	100.0	2.1	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	108.9	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	108.9	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	117.9	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	107.1	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	57.1	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	23.2	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	12.5	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	14.3	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	5.4	%	50 mM sodium phosphate	7.4	25	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	101.6	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	127.9	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	126.2	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	109.8	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	73.8	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	31.1	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	8.2	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	4.9	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	6.6	%	50 mM sodium phosphate	7.4	30	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	115.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	118.9	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	113.2	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	81.1	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	34.0	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	9.4	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	1.9	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	3.8	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	1.9	%	50 mM sodium phosphate	7.4	35	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	100.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	100.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	58.6	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	31.0	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	24.1	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	10.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	20.7	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	20.7	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	10.3	%	50 mM sodium phosphate	7.4	40	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	5%	100.0	189.5	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	10%	100.0	236.8	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	15%	100.0	121.1	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	20%	100.0	42.1	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	25%	100.0	31.6	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	30%	100.0	15.8	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	35%	100.0	10.5	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	40%	100.0	15.8	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Activity - Classical	Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent	Methanol	45%	100.0	21.1	%	50 mM sodium phosphate	7.4	45	10 mM Cyclohex-2-enone	Cyclohexane	0.2 mM NAD(P)H	—	Classical aqueous control (in %) \| Raw activity data of reaction temperature screening
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	Dimethylformamide (DMF)	—	—	23.0	% (v/v)	50 mM sodium phosphate	7.4	25	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	Dimethylformamide (DMF)	—	—	15.0	% (v/v)	50 mM sodium phosphate	7.4	30	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	Dimethylformamide (DMF)	—	—	13.0	% (v/v)	50 mM sodium phosphate	7.4	35	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	Dimethylformamide (DMF)	—	—	11.0	% (v/v)	50 mM sodium phosphate	7.4	40	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	Dimethyl Sulfoxide (DMSO)	—	—	41.0	% (v/v)	50 mM sodium phosphate	7.4	45	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	1-Propanol	—	—	11.0	% (v/v)	50 mM sodium phosphate	7.4	25	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	1-Propanol	—	—	10.0	% (v/v)	50 mM sodium phosphate	7.4	30	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	1-Propanol	—	—	8.0	% (v/v)	50 mM sodium phosphate	7.4	35	—	—	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume of organic solvent that leads to half-unfolding, measured by nanoDSF	1-Propanol	—	—	7.0	% (v/v)	50 mM sodium phosphate	7.4	40	—	—	—	—	Not applicable control (in % (v/v))
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	47.0	45.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	47.0	44.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	47.0	43.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	47.0	43.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	47.0	42.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	47.0	40.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	5%	47.0	44.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	10%	47.0	38.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	15%	47.0	35.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	20%	47.0	34.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	25%	47.0	32.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Ethanol	30%	47.0	30.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	5%	47.0	46.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	10%	47.0	40.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	15%	47.0	36.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	20%	47.0	37.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	25%	47.0	35.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Methanol	30%	47.0	31.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	5%	47.0	41.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	10%	47.0	36.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	15%	47.0	35.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	20%	47.0	33.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	25%	47.0	30.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	Isopropanol	30%	47.0	29.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	5%	47.0	39.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	10%	47.0	32.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	15%	47.0	29.67	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	20%	47.0	28.33	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	25%	47.0	27.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)
Stability - Tm	Melting temperature measured by ThermoFMN in the presence of organic solvent	1-Propanol	30%	47.0	27.0	°C	50 mM sodium phosphate	7.4	—	—	—	—	—	Classical aqueous control (in °C)

‹ Prev

1 2 3 4 … 8

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — C₅₀

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*