Haloalkane dehalogenase DhaA from Rhodococcus rhodochrous

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 293 amino acids
MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL
Veronika Stepankova et al. (2013) β€” Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases
Biotechnology Journal  Β· doi:10.1002/biot.201200378 β†—  Β· Activity - Classical Stability - C50 Stability - Tm
136 measurements
Database ID
UniProt: P0A3G2 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (136 measurements)

136 measurements β€” page 6 of 7
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol 75% 100 4 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-1000 75% 100 125 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Isopropanol 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Tetrahydrofuran (THF) 75% 100 0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Glycerol β€” β€” 75 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Formamide β€” β€” 30 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol β€” β€” 62 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) β€” β€” 48 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) β€” β€” 23 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol β€” β€” 25 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile β€” β€” 9 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
Stability - C50 Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol β€” β€” 22 % (v/v) glycine 100 mM 8.6 37 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Not applicable control (in % (v/v))
1 … 4 5 6 7

Visualization : Activity β€” Classical

Veronika Stepankova et al. (2013)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

Veronika Stepankova et al. (2013)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

Veronika Stepankova et al. (2013)

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Tana Koudelakova et al. (2013) β€” Engineering Enzyme Stability and Resistance to an Organic Cosolvent by Modification of Residues in the Access Tunnel
Angewandte Chemie International Edition  Β· doi:10.1002/anie.201206708 β†—  Β· Activity - Classical Activity - Michaelis-Menten Stability - C50 Stability - Inactivation Rate Constant Stability - Tm
66 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*