R-selective hydroxynitrile lyase from Arabidopsis thaliana

Enzyme Description

Extremophile
No
EC Number
4.1.2.10 β†— (Henry reaction)

Sequence

Length: 258 amino acids
MERKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM
Ken-ichi Fuhshuku et al. (2011) β€” Synthesis of (R)-Ξ²-nitro alcohols catalyzed by R-selective hydroxynitrile lyase from Arabidopsis thaliana in the aqueous–organic biphasic system
Journal of Biotechnology  Β· doi:10.1016/j.jbiotec.2011.03.011 β†—  Β· Activity + Stability - Product Formation Selectivity - Enantioselectivity
18 measurements
Database ID
UniProt: Q9LFT6 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Diisopropyl Ether 50% 68.25 66.75 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC tert-Butyl Methyl Ether (MTBE) 50% 68.25 26.0 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Ethyl Acetate 50% 68.25 7.25 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Butyl Acetate 50% 68.25 52.0 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC n-Hexane 50% 68.25 1.0 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Cyclohexane 50% 68.25 2.25 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Toluene 50% 68.25 23.75 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Xylene 50% 68.25 26.25 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Activity + Stability - Product Formation Product yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Diethyl Ether 50% 68.25 35.5 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Xylene 50% 24.0 81.75 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Toluene 50% 24.0 83.0 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Cyclohexane 50% 24.0 42.5 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC n-Hexane 50% 24.0 27.0 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Butyl Acetate 50% 24.0 95.75 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Ethyl Acetate 50% 24.0 49.5 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC tert-Butyl Methyl Ether (MTBE) 50% 24.0 61.25 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Diisopropyl Ether 50% 24.0 85.75 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (2 hours at 30Β°C) in the presence of organic solvent, measured by HPLC Diethyl Ether 50% 24.0 34.0 % 20 mM potassium phosphate buffer 7 30Β°C 25 Β΅M Benzaldehyde, 50 Β΅L Nitromethane (R)-2-Nitro-1-phenylethanol β€” 1200 rpm Classical aqueous control (in %)

Visualization : Activity + Stability β€” Product Formation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*