Feruloyl esterase C (gene faeC) from Talaromyces stipitatus

Enzyme Description

Species

Extremophile

EC Number

3.1.1.73 ↗

Sequence

Length: 530 amino acids

MMLTSAILLLTLGVQLSHADDSSRENFSNRCDQLAKEIHIPNVTVNFVEYVANGTNVTLADNPPSCGQSNQVVLADLCRVAMEVTTSNQSQITLEAWFPENYTGRFLSTGNGGLAGCIQYVDMAYASSMGFATVGANGGHNGTSGESFYHNPDIVEDLSWRSVHTGVVVGKELTKKFYHEGFHKSYYLGCSTGGRQGFKAVQEFVHDFDGVVAGCPAFNFVNLNSWSGHFYPITGNSSADTFLTTAQWTLVQQSVMEQCDSLDGAVDGVIEAIDQCHPVFEQLICRPGQNASECLTGKQVNTAQLVLSPIYGTKGEFLYPRMQPGVENVDMYITYNGDPFAYSTDWYKYVVFSDPNWDPATLNAQDYEIALAQNPSNIQTFEGDLSAFRDAGAKVLTYHGTADPIITGETSKVYYRHVAETMNAAPEELDEFYRYFRIGGMSHCGGGTGATAIGNVLSAQWSNDPDANVLMAMVRWVEEGVAPEYIRGASLGSGPGAKVEYTRRHCKYPTRNVYVGPGNWTDENAWKCIL

Craig B. Faulds et al. (2011) — Influence of organic co-solvents on the activity and substrate specificity of feruloyl esterases

Bioresource Technology · doi:10.1016/j.biortech.2011.01.088 ↗ · Activity - Classical Activity - Michaelis-Menten Stability - C50 Stability - Incubation Activity + Stability - Incubation

146 measurements ▼

Database ID

UniProt: B8LV47 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host yeast Pichia pastoris

Experimental Data (146 measurements)

146 measurements — page 7 of 8

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	5.61	15.69	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in microM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	5.61	33.2	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in microM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	5.61	43.49	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in microM)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	19315.0	19513.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	19315.0	23445.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	19315.0	42835.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	19315.0	55605.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	19315.0	54254.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	3443.0	3399.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	3443.0	3443.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	3443.0	2730.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	3443.0	1675.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	3443.0	1248.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	1168.0	795.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	1168.0	1036.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	1223.0	1112.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	1223.0	1074.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	33.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	23.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	—	—	19.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Not applicable control (in % (v/v))

Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	95.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	100.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	107.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	105.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	100.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	80.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	64.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	19.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	1%	100.0	100.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	96.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	100.0	86.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	15%	100.0	57.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	20%	100.0	46.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	1%	100.0	97.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	5%	100.0	84.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	10%	100.0	63.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	15%	100.0	34.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	20%	100.0	14.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	25%	100.0	6.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	30%	100.0	4.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Methanol	2%	100.0	104.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Ethanol	2%	100.0	110.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1-Propanol	2%	100.0	101.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Methanol	5%	100.0	95.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Ethanol	5%	100.0	102.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1-Propanol	5%	100.0	86.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Methanol	10%	100.0	72.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Ethanol	10%	100.0	81.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1-Propanol	10%	100.0	63.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	89.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	86.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	84.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	71.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	57.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	37.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	28.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	35%	100.0	11.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	1.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	60%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	40%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	1%	100.0	88.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	59.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	100.0	31.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	15%	100.0	8.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	20%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	30%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	40%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	107.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	120.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	101.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	89.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	42.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	31.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	18.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	35%	100.0	0.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	0.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	1%	100.0	94.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	5%	100.0	90.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	10%	100.0	93.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	15%	100.0	89.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	20%	100.0	78.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	25%	100.0	69.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	30%	100.0	63.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	35%	100.0	60.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	40%	100.0	53.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	50%	100.0	36.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	75%	100.0	9.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	98%	100.0	4.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	96.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	81.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	65.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	20.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	1.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	95.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	15%	100.0	57.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	20%	100.0	47.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	100.0	2.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	5%	100.0	100.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	10%	100.0	94.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	15%	100.0	83.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	20%	100.0	63.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	25%	100.0	60.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	30%	100.0	50.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	35%	100.0	38.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	40%	100.0	29.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Glycerol	50%	100.0	13.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2%	100.0	90.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	87.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	85.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	72.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	59.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	38.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	29.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	35%	100.0	13.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	3.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	2%	100.0	89.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	60.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	100.0	32.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	15%	100.0	8.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	2.22	3.4	µM	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	2.22	4.28	µM	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	2.22	4.14	µM	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	2.22	7.29	µM	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	2.22	7.45	µM	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	28019.0	28223.0	U/mg	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	28019.0	31913.0	U/mg	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	28019.0	37400.0	U/mg	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	28019.0	45327.0	U/mg	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	28019.0	38839.0	U/mg	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	12621.0	8301.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	12621.0	7456.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	12621.0	9064.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	12621.0	6218.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	12621.0	5213.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	5.61	5.74	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	5.61	6.81	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	5.61	15.69	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	5.61	33.2	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Km (in µM) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	5.61	43.49	µM	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in µM)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	19315.0	19513.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	19315.0	23445.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	19315.0	42835.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	19315.0	55605.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax (in U/mg) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	19315.0	54254.0	U/mg	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in U/mg)
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	3443.0	3399.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	3%	3443.0	3443.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	3443.0	2730.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	3443.0	1675.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity - Michaelis-Menten	Vmax/Km (in L/(min*mg)) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	3443.0	1248.0	L/(min * mg)	100 mM MOPS	6	37°C	Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in L/(min * mg))
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	1168.0	795.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	1168.0	1036.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	1223.0	1112.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	1223.0	1074.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	33.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	23.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	—	—	19.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	—	—	8.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	—	—	13.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Not applicable control (in % (v/v))
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	1187.0	795.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	1276.0	1036.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	1178.0	1112.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	952.0	1074.0	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent

‹ Prev

1 … 5 6 7 8

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity — Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — C₅₀

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Feruloyl esterase C (gene faeC) from Talaromyces stipitatus

Enzyme Description

Sequence

Experimental Data (146 measurements)

Visualization : Activity — Classical

Visualization : Activity — Michaelis-Menten

Visualization : Stability — Incubation

Visualization : Activity + Stability — Incubation

Visualization : Stability — C50

Structure

Loading…

Visualization : Stability — C₅₀