Feruloyl esterase C (gene faeC) from Talaromyces stipitatus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 530 amino acids
MMLTSAILLLTLGVQLSHADDSSRENFSNRCDQLAKEIHIPNVTVNFVEYVANGTNVTLADNPPSCGQSNQVVLADLCRVAMEVTTSNQSQITLEAWFPENYTGRFLSTGNGGLAGCIQYVDMAYASSMGFATVGANGGHNGTSGESFYHNPDIVEDLSWRSVHTGVVVGKELTKKFYHEGFHKSYYLGCSTGGRQGFKAVQEFVHDFDGVVAGCPAFNFVNLNSWSGHFYPITGNSSADTFLTTAQWTLVQQSVMEQCDSLDGAVDGVIEAIDQCHPVFEQLICRPGQNASECLTGKQVNTAQLVLSPIYGTKGEFLYPRMQPGVENVDMYITYNGDPFAYSTDWYKYVVFSDPNWDPATLNAQDYEIALAQNPSNIQTFEGDLSAFRDAGAKVLTYHGTADPIITGETSKVYYRHVAETMNAAPEELDEFYRYFRIGGMSHCGGGTGATAIGNVLSAQWSNDPDANVLMAMVRWVEEGVAPEYIRGASLGSGPGAKVEYTRRHCKYPTRNVYVGPGNWTDENAWKCIL
Craig B. Faulds et al. (2011) β€” Influence of organic co-solvents on the activity and substrate specificity of feruloyl esterases
Bioresource Technology  Β· doi:10.1016/j.biortech.2011.01.088 β†—  Β· Activity - Classical Activity - Michaelis-Menten Stability - C50 Stability - Incubation Activity + Stability - Incubation
146 measurements
Database ID
UniProt: B8LV47 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (146 measurements)

146 measurements β€” page 2 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 25% 100.0 6.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 30% 100.0 4.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Methanol 2% 100.0 104.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Ethanol 2% 100.0 110.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1-Propanol 2% 100.0 101.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Methanol 5% 100.0 95.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Ethanol 5% 100.0 102.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1-Propanol 5% 100.0 86.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Methanol 10% 100.0 72.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Ethanol 10% 100.0 81.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1-Propanol 10% 100.0 63.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 1% 100.0 89.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 86.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 84.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 71.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100.0 57.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25% 100.0 37.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 28.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 35% 100.0 11.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40% 100.0 1.0 % 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
1 2 3 4 … 8

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*